BP913001
Clone id YMU001_000025_C06
Library
Length 453
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000025_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTAGAAATAGAGCAATGACAATAGATTGCACTTGAATGGAGAGTGAA
GGCCTTGTTACAAATGAGGGCAGCTAATGGGATTTATATACAAGTTGAGGGAGTGAGGAT
TATCCATCACATGGGAATTATAGGTAGGTGGGAATAGACACATGTTGAGGTTTGCATAGG
TAAAAGGGGTCCATGTGGGAATTAGGGAATAGAGGTAGGTGGAAAGGAAGTCCACACTTA
TTATAATCATAAGTTACTTTTACATGGGGATGCCTCCAGTGAGAAGGTTCGAGGAGAGAT
TGAGGTCATACATGAAAGTGAGGTTCCCTAGCAGTGGTGTAAGAGAACCTGCAAACCCAG
AGCCTGCCAAGTTTATGCCAGCAACATGGGATTGTCCAGAGACATAAGCGCAAGTGATTC
CTCCCCATGATTTGCAACTGTTATTCGAATTAC
■■Homology search results ■■ -
sp_hit_id Q9LVM0
Definition sp|Q9LVM0|Y5830_ARATH Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana
Align length 63
Score (bit) 47.0
E-value 3.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913001|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_C06.
(438 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LVM0|Y5830_ARATH Probable inactive receptor kinase At5g5830... 47 3e-05
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein ... 45 2e-04
sp|Q9FHK7|Y5516_ARATH Probable receptor kinase At5g05160 OS=Arab... 44 2e-04
sp|Q6R2K2|SRF4_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Ara... 42 0.001
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil... 41 0.002
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/thr... 41 0.002
sp|Q9SUQ3|Y4374_ARATH Probable inactive receptor kinase At4g2374... 40 0.004
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 40 0.004
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 39 0.009
sp|Q6R2K3|SRF3_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Ara... 38 0.021
sp|Q9C9Y8|Y3868_ARATH Probable inactive receptor kinase At3g0868... 37 0.028
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 37 0.047
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Ar... 36 0.080
sp|Q3APX4|MEND_CHLCH 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cycloh... 32 0.12
sp|Q9LP77|Y1848_ARATH Probable inactive receptor kinase At1g4848... 35 0.14
sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 35 0.14
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabido... 35 0.18
sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g1002... 34 0.23
sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1 OS=Ar... 34 0.23
sp|Q94C77|RPKL_ARATH Receptor protein kinase-like protein At4g34... 34 0.23
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2... 34 0.23
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidops... 33 0.40
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 33 0.40
sp|Q5PP26|PII2_ARATH Piriformospora indica-insensitive protein 2... 33 0.40
sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT10... 33 0.40
sp|Q9FK10|Y5332_ARATH Probable inactive receptor kinase At5g5332... 33 0.68
sp|Q06BH3|SRF1_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Ara... 33 0.68
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arab... 33 0.68
sp|A1BI74|MEND_CHLPD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cycloh... 32 0.89
sp|Q3B612|MEND_PELLD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cycloh... 32 1.5

>sp|Q9LVM0|Y5830_ARATH Probable inactive receptor kinase At5g58300
OS=Arabidopsis thaliana GN=At5g58300 PE=1 SV=1
Length = 654

Score = 47.0 bits (110), Expect = 3e-05
Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTP-LLGNLTFMYDLNLSSNLLTG 260
++N+ CKSW G+TC S + V + L G G G + P LG L + L+L SNLL+G
Sbjct: 69 STNHICKSWVGVTC--TSDGTSVHALRLPGIGLLGPIPPNTLGKLESLRILSLRSNLLSG 126

Query: 259 GIP 251
+P
Sbjct: 127 NLP 129


>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein
kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1
Length = 1173

Score = 44.7 bits (104), Expect = 2e-04
Identities = 22/55 (40%), Positives = 31/55 (56%)
Frame = -3

Query: 415 SWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+W GITC HV ++L G L+P + NLT++ L+L+SN TG IP
Sbjct: 62 NWTGITC---DSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIP 113



Score = 40.4 bits (93), Expect = 0.003
Identities = 20/53 (37%), Positives = 29/53 (54%)
Frame = -3

Query: 409 GGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
G I G + +NL+ + F+G + GN+T + L+LSSN LTG IP
Sbjct: 687 GHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIP 739



Score = 32.7 bits (73), Expect = 0.68
Identities = 17/41 (41%), Positives = 23/41 (56%)
Frame = -3

Query: 373 HVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
H+ AG+ GS+ +G L + DL+LS N LTG IP
Sbjct: 193 HLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIP 233



Score = 32.3 bits (72), Expect = 0.89
Identities = 16/42 (38%), Positives = 26/42 (61%)
Frame = -3

Query: 376 SHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
S++ +++A + G+L PL+G L + L +S N LTG IP
Sbjct: 455 SNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIP 496



Score = 32.3 bits (72), Expect = 0.89
Identities = 21/61 (34%), Positives = 32/61 (52%)
Frame = -3

Query: 433 SNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGI 254
SNN + G A S + ++L G+ F GS+ L +L+ + ++S NLLTG I
Sbjct: 559 SNNK---FSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTI 615

Query: 253 P 251
P
Sbjct: 616 P 616



Score = 29.3 bits (64), Expect = 7.5
Identities = 14/42 (33%), Positives = 24/42 (57%)
Frame = -3

Query: 376 SHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+++ ++L+G+ G + GNL + L L+ NLL G IP
Sbjct: 216 ANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIP 257



Score = 29.3 bits (64), Expect = 7.5
Identities = 20/55 (36%), Positives = 28/55 (50%)
Frame = -3

Query: 355 LAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM*K*LMIIISVDFLSTYLYS 191
L +GF G + + NLT + L + SN L G IP M ++SV LS +S
Sbjct: 510 LHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFS 564


>sp|Q9FHK7|Y5516_ARATH Probable receptor kinase At5g05160
OS=Arabidopsis thaliana GN=At5g05160 PE=1 SV=1
Length = 640

Score = 44.3 bits (103), Expect = 2e-04
Identities = 28/64 (43%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
Frame = -3

Query: 436 NSNNS-CKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTP-LLGNLTFMYDLNLSSNLLT 263
N N S C SW GITC + S V + L G G GS+ P LG L + L+L SN L
Sbjct: 52 NKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLF 111

Query: 262 GGIP 251
G +P
Sbjct: 112 GTLP 115


>sp|Q6R2K2|SRF4_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 4
OS=Arabidopsis thaliana GN=SRF4 PE=2 SV=1
Length = 687

Score = 41.6 bits (96), Expect = 0.001
Identities = 24/55 (43%), Positives = 31/55 (56%)
Frame = -3

Query: 415 SWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
SW GITC S V I ++G G +GSL LGNL + L++S N L G +P
Sbjct: 62 SWDGITCK----GSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLP 112


>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil
GN=INRPK1 PE=2 SV=2
Length = 1109

Score = 41.2 bits (95), Expect = 0.002
Identities = 19/46 (41%), Positives = 29/46 (63%)
Frame = -3

Query: 388 VSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+S H+ + L+G+GF GS+ LGN + + ++LSSN TG IP
Sbjct: 88 ISHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHIDLSSNSFTGNIP 133



Score = 35.8 bits (81), Expect = 0.080
Identities = 17/36 (47%), Positives = 24/36 (66%)
Frame = -3

Query: 358 NLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+L+G+ F G + P LGNL + + LSSN L+G IP
Sbjct: 505 DLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIP 540



Score = 34.7 bits (78), Expect = 0.18
Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 7/65 (10%)
Frame = -3

Query: 424 SCKSWGGITCAYVS------GQ-SHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLL 266
S + +G +CA GQ + + + LAG+ F+G + P LG M DL L N L
Sbjct: 285 SLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQL 344

Query: 265 TGGIP 251
G IP
Sbjct: 345 EGEIP 349



Score = 34.3 bits (77), Expect = 0.23
Identities = 17/41 (41%), Positives = 26/41 (63%)
Frame = -3

Query: 373 HVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+V I L+ + +GS+ P LG+L + LNLS N+L G +P
Sbjct: 524 NVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILP 564



Score = 30.8 bits (68), Expect = 2.6
Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 16/132 (12%)
Frame = -3

Query: 409 GGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM-*K*LM 233
GGI + + + L G+ AG + P+ G L + LNLSSN L G +P+ L
Sbjct: 609 GGIPTSLFQSNK-LLNLQLGGNLLAGDIPPV-GALQALRSLNLSSNKLNGQLPIDLGKLK 666

Query: 232 IIISVDFLSTYL---YSLIPTWTPFTYANLNMCLF----PPTYNSHVMDNPHS------- 95
++ +D L ++ T T+ N++ LF PP+ + +P S
Sbjct: 667 MLEELDVSHNNLSGTLRVLSTIQSLTFINISHNLFSGPVPPSLTKFLNSSPTSFSGNSDL 726

Query: 94 -LNLYINPISCP 62
+N + ++CP
Sbjct: 727 CINCPADGLACP 738



Score = 30.0 bits (66), Expect = 4.4
Identities = 19/53 (35%), Positives = 28/53 (52%)
Frame = -3

Query: 409 GGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
G I +VS + + I+L+ + F G L P LGN T + + S L+G IP
Sbjct: 250 GAIPLDFVSCKQ-IDTISLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIP 301



Score = 29.6 bits (65), Expect = 5.7
Identities = 14/47 (29%), Positives = 26/47 (55%)
Frame = -3

Query: 388 VSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM 248
+ S + + L + F+G + LGN+T + +L L+ N L G +P+
Sbjct: 184 IGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPV 230



Score = 28.9 bits (63), Expect = 9.8
Identities = 16/52 (30%), Positives = 29/52 (55%)
Frame = -3

Query: 406 GITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
GI + +S ++ ++ + + GS+ LG+LT + L+L N +GGIP
Sbjct: 561 GILPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIP 612


>sp|O64483|SIRK_ARATH Senescence-induced receptor-like
serine/threonine-protein kinase OS=Arabidopsis thaliana
GN=SIRK PE=2 SV=1
Length = 876

Score = 40.8 bits (94), Expect = 0.002
Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
Frame = -3

Query: 415 SWGGITCAYVSGQSH--VAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
SW GI C ++ V +N++ S G + P NLT + L+LS N LTG IP
Sbjct: 399 SWEGIDCIQSDNTTNPRVVSLNISFSELRGQIDPAFSNLTSIRKLDLSGNTLTGEIP 455



Score = 31.2 bits (69), Expect = 2.0
Identities = 14/45 (31%), Positives = 25/45 (55%)
Frame = -3

Query: 385 SGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
S + + ++L+G+ G + L NL + +LN+ N LTG +P
Sbjct: 435 SNLTSIRKLDLSGNTLTGEIPAFLANLPNLTELNVEGNKLTGIVP 479


>sp|Q9SUQ3|Y4374_ARATH Probable inactive receptor kinase At4g23740
OS=Arabidopsis thaliana GN=At4g23740 PE=1 SV=1
Length = 638

Score = 40.0 bits (92), Expect = 0.004
Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
Frame = -3

Query: 373 HVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM*K*LMIIISVDFLSTY-L 197
++ +NL+ +GF G++ L L + LNL++N L+G IP L + +D + Y L
Sbjct: 142 NLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDL 201

Query: 196 YSLIPTWT---PF-TYANLNMCLFPPTYNSHVMDNP 101
IP W PF +Y ++ + PP N ++ P
Sbjct: 202 AGPIPDWLRRFPFSSYTGID--IIPPGGNYTLVTPP 235


>sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum
GN=NORK PE=1 SV=1
Length = 924

Score = 40.0 bits (92), Expect = 0.004
Identities = 29/103 (28%), Positives = 48/103 (46%)
Frame = -3

Query: 412 WGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM*K*LM 233
W G+ C +G S + ++L+ S G++ + +T + LNLS N G IP
Sbjct: 393 WKGVACDGSNGSSVITKLDLSSSNLKGTIPSSVTEMTKLQILNLSHNHFDGYIPSFPPSS 452

Query: 232 IIISVDFLSTYLYSLIPTWTPFTYANLNMCLFPPTYNSHVMDN 104
++ISVD L +P + + +LN F N H+ D+
Sbjct: 453 LLISVDLSYNDLTGQLPE-SIISLPHLNSLYF--GCNQHMRDD 492


>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1
OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1
Length = 1095

Score = 38.9 bits (89), Expect = 0.009
Identities = 23/62 (37%), Positives = 36/62 (58%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
NS+ C SW GI+C S ++ V I L+ G +G+L + +L + L+LS N L+G
Sbjct: 73 NSSIDCCSWEGISCD-KSPENRVTSIILSSRGLSGNLPSSVLDLQRLSRLDLSHNRLSGP 131

Query: 256 IP 251
+P
Sbjct: 132 LP 133



Score = 35.4 bits (80), Expect = 0.10
Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 6/71 (8%)
Frame = -3

Query: 361 INLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM*K*LMIIISVDFLSTY------ 200
+ L G+ F+GS+ L NLT + L+LS+N L+G IP + + FLS +
Sbjct: 610 LELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIP-----WSLTGLHFLSYFNVANNT 664

Query: 199 LYSLIPTWTPF 167
L IPT T F
Sbjct: 665 LSGPIPTGTQF 675



Score = 31.6 bits (70), Expect = 1.5
Identities = 19/58 (32%), Positives = 33/58 (56%)
Frame = -3

Query: 424 SCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+C+ G I A++ V ++L+ + F G++ LG L ++ L+LS N LTG +P
Sbjct: 480 ACRLTGEIP-AWLIKLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSDNFLTGELP 536


>sp|Q6R2K3|SRF3_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 3
OS=Arabidopsis thaliana GN=SRF3 PE=1 SV=1
Length = 776

Score = 37.7 bits (86), Expect = 0.021
Identities = 20/59 (33%), Positives = 38/59 (64%), Gaps = 1/59 (1%)
Frame = -3

Query: 355 LAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP-M*K*LMIIISVDFLSTYLYSLIP 182
L+ + F GS+ LG L+F+ D++L+ NLL+G +P + + L+ +I++D S + +P
Sbjct: 127 LSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLP 185


tr_hit_id Q5Z670
Definition tr|Q5Z670|Q5Z670_ORYSJ Leucine-rich receptor-like protein kinase-like (Putative uncharacterized protein) OS=Oryza sativa subsp. japonica
Align length 68
Score (bit) 57.4
E-value 4.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913001|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_C06.
(438 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5Z670|Q5Z670_ORYSJ Leucine-rich receptor-like protein kinase... 57 4e-07
tr|Q0JQL8|Q0JQL8_ORYSJ Os01g0152600 protein (Putative uncharacte... 57 4e-07
tr|B8ADC1|B8ADC1_ORYSI Putative uncharacterized protein OS=Oryza... 57 4e-07
tr|A2ZBY5|A2ZBY5_ORYSI Putative uncharacterized protein OS=Oryza... 57 4e-07
tr|Q53PD4|Q53PD4_ORYSJ Leucine Rich Repeat family protein, expre... 57 5e-07
tr|A2ZBY7|A2ZBY7_ORYSI Putative uncharacterized protein OS=Oryza... 57 5e-07
tr|Q5Z664|Q5Z664_ORYSJ Putative disease resistance protein OS=Or... 57 6e-07
tr|Q0D9Y1|Q0D9Y1_ORYSJ Os06g0692700 protein (Fragment) OS=Oryza ... 57 6e-07
tr|B8B1U8|B8B1U8_ORYSI Putative uncharacterized protein OS=Oryza... 57 6e-07
tr|B8AI51|B8AI51_ORYSI Putative uncharacterized protein OS=Oryza... 57 6e-07
tr|A3BEX4|A3BEX4_ORYSJ Putative uncharacterized protein OS=Oryza... 57 6e-07
tr|Q53PD7|Q53PD7_ORYSJ Leucine Rich Repeat family protein OS=Ory... 56 1e-06
tr|Q67IT7|Q67IT7_ORYSJ Os02g0153400 protein OS=Oryza sativa subs... 55 2e-06
tr|Q66QA4|Q66QA4_ORYSI Putative leucine-rich repeat receptor-lik... 55 2e-06
tr|Q5ZD75|Q5ZD75_ORYSJ cDNA clone:J033106J03, full insert sequen... 55 2e-06
tr|Q5UD36|Q5UD36_ORYRU Putative leucine-rich repeat receptor-lik... 55 2e-06
tr|Q2QM26|Q2QM26_ORYSJ Leucine Rich Repeat family protein (Putat... 55 2e-06
tr|A2ZPD1|A2ZPD1_ORYSJ Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A2ZBY3|A2ZBY3_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A2X110|A2X110_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A2WKS7|A2WKS7_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|Q65XS3|Q65XS3_ORYSJ Putative uncharacterized protein P0685E10... 54 4e-06
tr|Q5ZED4|Q5ZED4_ORYSJ Putative uncharacterized protein P0434B04... 54 4e-06
tr|Q0JQN7|Q0JQN7_ORYSJ Os01g0149700 protein OS=Oryza sativa subs... 54 4e-06
tr|Q0E3S5|Q0E3S5_ORYSJ Os02g0157200 protein OS=Oryza sativa subs... 54 4e-06
tr|Q0DKE1|Q0DKE1_ORYSJ Os05g0170300 protein OS=Oryza sativa subs... 54 4e-06
tr|B8AYZ4|B8AYZ4_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|B8AI52|B8AI52_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A3B0E4|A3B0E4_ORYSJ Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A3A9N0|A3A9N0_ORYSJ Putative uncharacterized protein OS=Oryza... 54 4e-06

>tr|Q5Z670|Q5Z670_ORYSJ Leucine-rich receptor-like protein
kinase-like (Putative uncharacterized protein) OS=Oryza
sativa subsp. japonica GN=P0532H03.25 PE=4 SV=1
Length = 254

Score = 57.4 bits (137), Expect = 4e-07
Identities = 32/68 (47%), Positives = 41/68 (60%)
Frame = -3

Query: 421 CKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM*K 242
C SW GI C G++ V I+L G AGS++P L NLT + LNLS N L+GG+PM
Sbjct: 9 CCSWEGINCR---GENTVRDISLPSKGLAGSISPSLSNLTKLLHLNLSHNSLSGGLPMDS 65

Query: 241 *LMIIISV 218
L I+V
Sbjct: 66 LLFSSIAV 73


>tr|Q0JQL8|Q0JQL8_ORYSJ Os01g0152600 protein (Putative uncharacterized
protein) OS=Oryza sativa subsp. japonica GN=Os01g0152600
PE=4 SV=1
Length = 1410

Score = 57.4 bits (137), Expect = 4e-07
Identities = 29/62 (46%), Positives = 40/62 (64%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
+S NS SW G+TC++ + V ++L S AG+L+P +GNLTF+ LNLSSN L
Sbjct: 1052 SSANSFCSWEGVTCSHRRRPTSVVALDLPSSDLAGTLSPAIGNLTFLRRLNLSSNDLHSE 1111

Query: 256 IP 251
IP
Sbjct: 1112 IP 1113



Score = 52.0 bits (123), Expect = 1e-05
Identities = 29/62 (46%), Positives = 39/62 (62%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
+S S +W G+TC+ + VA ++L S AG+L+P +GNLTF LNLSSN L G
Sbjct: 51 SSGASFCNWEGVTCSR-RRPTRVASLSLPSSNLAGTLSPAIGNLTFPRRLNLSSNGLYGE 109

Query: 256 IP 251
IP
Sbjct: 110 IP 111


>tr|B8ADC1|B8ADC1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_00436 PE=4 SV=1
Length = 1130

Score = 57.4 bits (137), Expect = 4e-07
Identities = 29/62 (46%), Positives = 40/62 (64%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
+S NS SW G+TC++ + V ++L S AG+L+P +GNLTF+ LNLSSN L
Sbjct: 878 SSANSFCSWEGVTCSHRRRPTSVVALDLPSSDLAGTLSPAIGNLTFLRRLNLSSNDLHSE 937

Query: 256 IP 251
IP
Sbjct: 938 IP 939



Score = 53.5 bits (127), Expect = 5e-06
Identities = 29/62 (46%), Positives = 40/62 (64%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
+S S +W G+TC+ + VA ++L S AG+L+P +GNLTF+ LNLSSN L G
Sbjct: 51 SSGASFCNWEGVTCSR-RRPTRVASLSLPSSNLAGTLSPAIGNLTFLRRLNLSSNGLYGE 109

Query: 256 IP 251
IP
Sbjct: 110 IP 111


>tr|A2ZBY5|A2ZBY5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35291 PE=4 SV=1
Length = 993

Score = 57.4 bits (137), Expect = 4e-07
Identities = 27/63 (42%), Positives = 38/63 (60%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
N +N SW G+ C V V ++L+G G GS++P LGNLTF+ +NL NL+ G
Sbjct: 54 NDSNHVCSWEGVKCR-VKAPHRVISLDLSGQGLVGSISPSLGNLTFLRYINLQENLIAGQ 112

Query: 256 IPM 248
IP+
Sbjct: 113 IPL 115


>tr|Q53PD4|Q53PD4_ORYSJ Leucine Rich Repeat family protein,
expressed OS=Oryza sativa subsp. japonica
GN=Os11g0173300 PE=4 SV=1
Length = 1024

Score = 57.0 bits (136), Expect = 5e-07
Identities = 27/62 (43%), Positives = 36/62 (58%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
N +N SW G+ C V +HV +NL G+++P LGNLTF+ LNL+ N TG
Sbjct: 55 NDSNQVCSWEGVFCR-VKAPNHVVALNLTNRDLVGTISPSLGNLTFLKHLNLTGNAFTGQ 113

Query: 256 IP 251
IP
Sbjct: 114 IP 115



Score = 32.7 bits (73), Expect = 9.2
Identities = 15/52 (28%), Positives = 25/52 (48%)
Frame = -3

Query: 406 GITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
G+ YV H+ + L+ + +G + LGN + + N+ TGGIP
Sbjct: 501 GLLPFYVGNAKHLIYLVLSSNNLSGEIPNTLGNSESLQIIKFDHNIFTGGIP 552


>tr|A2ZBY7|A2ZBY7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35293 PE=4 SV=1
Length = 815

Score = 57.0 bits (136), Expect = 5e-07
Identities = 27/62 (43%), Positives = 36/62 (58%)
Frame = -3

Query: 436 NSNNSCKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGG 257
N +N SW G+ C V +HV +NL G+++P LGNLTF+ LNL+ N TG
Sbjct: 55 NDSNQVCSWEGVFCR-VKAPNHVVALNLTNRDLVGTISPSLGNLTFLKHLNLTGNAFTGQ 113

Query: 256 IP 251
IP
Sbjct: 114 IP 115


>tr|Q5Z664|Q5Z664_ORYSJ Putative disease resistance protein OS=Oryza
sativa subsp. japonica GN=P0532H03.34 PE=4 SV=1
Length = 673

Score = 56.6 bits (135), Expect = 6e-07
Identities = 29/58 (50%), Positives = 34/58 (58%)
Frame = -3

Query: 421 CKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM 248
C W GITC S V + LA G G ++PLLGNLT + LNLS NLL G +PM
Sbjct: 9 CCKWEGITC---SSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPM 63



Score = 34.3 bits (77), Expect = 3.2
Identities = 15/37 (40%), Positives = 22/37 (59%)
Frame = -3

Query: 361 INLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+NL +GF G + P +G L + N+S N L+G IP
Sbjct: 500 LNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIP 536


>tr|Q0D9Y1|Q0D9Y1_ORYSJ Os06g0692700 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os06g0692700 PE=4 SV=1
Length = 735

Score = 56.6 bits (135), Expect = 6e-07
Identities = 29/58 (50%), Positives = 34/58 (58%)
Frame = -3

Query: 421 CKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM 248
C W GITC S V + LA G G ++PLLGNLT + LNLS NLL G +PM
Sbjct: 71 CCKWEGITC---SSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPM 125



Score = 34.3 bits (77), Expect = 3.2
Identities = 15/37 (40%), Positives = 22/37 (59%)
Frame = -3

Query: 361 INLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+NL +GF G + P +G L + N+S N L+G IP
Sbjct: 562 LNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIP 598


>tr|B8B1U8|B8B1U8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24277 PE=4 SV=1
Length = 769

Score = 56.6 bits (135), Expect = 6e-07
Identities = 29/58 (50%), Positives = 34/58 (58%)
Frame = -3

Query: 421 CKSWGGITCAYVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM 248
C W GITC S V + LA G G ++PLLGNLT + LNLS NLL G +PM
Sbjct: 95 CCKWEGITC---SSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPM 149



Score = 34.3 bits (77), Expect = 3.2
Identities = 15/37 (40%), Positives = 22/37 (59%)
Frame = -3

Query: 361 INLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP 251
+NL +GF G + P +G L + N+S N L+G IP
Sbjct: 586 LNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIP 622


>tr|B8AI51|B8AI51_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05914 PE=4 SV=1
Length = 655

Score = 56.6 bits (135), Expect = 6e-07
Identities = 43/108 (39%), Positives = 56/108 (51%), Gaps = 7/108 (6%)
Frame = -3

Query: 421 CKSWGGITCA-YVSGQSHVAGINLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIP-- 251
C SW GITC+ VS + V + LA GS++P LG L + LNLS N L+GG+P
Sbjct: 52 CCSWEGITCSSMVSKDAMVTDVLLASKRLEGSISPALGRLPGLLRLNLSHNSLSGGLPSE 111

Query: 250 -M*K*LMIIISVDFLSTYLYSLIPTWTPFTYA---NLNMCLFPPTYNS 119
M +II+ V F S L ++P P T L +CL T NS
Sbjct: 112 VMSSGSIIILDVSFNS--LGRILPLSPPLTTGLKLPLQLCLNSVTTNS 157



Score = 33.5 bits (75), Expect = 5.4
Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
Frame = -3

Query: 361 INLAGSGFAGSLTPLLGNLTFMYDLNLSSNLLTGGIPM-*K*LMIIISVDFLSTYLYSLI 185
++L + F G + P +G L + +LNLS+N L G IP L ++++D S L I
Sbjct: 471 LDLGSNKFTGLIPPEIGQLKGLLELNLSANKLYGDIPQSICNLTNLLTLDLSSNKLSGTI 530

Query: 184 PTWTPFTYANLN-MCLFPPTYN 122
P NLN + F +YN
Sbjct: 531 PA----ALKNLNFLTRFNISYN 548