BP913007
Clone id YMU001_000025_D02
Library
Length 284
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000025_D02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGAGAGCCCTCTTTGCAAAAGTATGGCTGCAACTACGCTAGGATTACAGGAGAATGCAAC
CTTGCAGAATCGTGGAGGCATCCATGTTGATGGTGCCATGGGAGCTGATGTTACATTTGC
ACTTGGTGGCAAAGACACGTCAGAGCTTGAAGATTGCACAATATCAGGAAAAATTTCACC
TCCAAGCTGCCAAACAGGTATGAACAATGCCACGATTGCAGCTGGAGGCCAACCCCAAGA
AGATGAGCCTACTCTAACTGCAGGTGGTGGGAATGACCAAATTC
■■Homology search results ■■ -
sp_hit_id Q5DTZ6
Definition sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus
Align length 90
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913007|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_D02.
(284 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN... 31 1.7
sp|P33344|YEHE_ECOLI Uncharacterized protein yehE OS=Escherichia... 30 2.8
sp|Q6PEH9|S39AA_DANRE Zinc transporter ZIP10 OS=Danio rerio GN=s... 30 4.9
sp|Q8B119|GLYC_PIRVV Pre-glycoprotein polyprotein GP complex OS=... 30 4.9
sp|Q554L3|Y5003_DICDI Putative uncharacterized protein DDB_G0275... 29 6.3
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase... 29 6.3
sp|A0Q2E1|ANSME_CLONN Anaerobic sulfatase-maturating enzyme OS=C... 29 8.3

>sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus
GN=Rnf150 PE=2 SV=2
Length = 437

Score = 31.2 bits (69), Expect = 1.7
Identities = 20/90 (22%), Positives = 35/90 (38%)
Frame = +2

Query: 8 PLCKSMAATTLGLQENATLQNRGGIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPS 187
P+CK LG+ NA + I +G++G T + G + + + +++ + P
Sbjct: 315 PMCKMNILKALGIPPNADCMDDLPIDFEGSLGGPPTNQITGASDTTVNESSVT--LDPAV 372

Query: 188 CQTGMNNATIAAGGQPQEDEPTLTAGGGND 277
G PQE E T G +
Sbjct: 373 RTVGALQVVQDPDPAPQEGEAIFTTNSGQE 402


>sp|P33344|YEHE_ECOLI Uncharacterized protein yehE OS=Escherichia
coli (strain K12) GN=yehE PE=4 SV=1
Length = 93

Score = 30.4 bits (67), Expect = 2.8
Identities = 17/41 (41%), Positives = 22/41 (53%)
Frame = +2

Query: 137 TSELEDCTISGKISPPSCQTGMNNATIAAGGQPQEDEPTLT 259
+SE I+G+ISPP+C M N GQPQ+ LT
Sbjct: 22 SSETATLAINGRISPPTCSMAMVN------GQPQQHCGQLT 56


>sp|Q6PEH9|S39AA_DANRE Zinc transporter ZIP10 OS=Danio rerio
GN=slc39a10 PE=2 SV=1
Length = 847

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
Frame = -1

Query: 161 LCNLQALTCLCHQVQM*HQLPWHHQHGCLH-DSARLHS 51
LC L LT L HQ H+ HH HG H D +HS
Sbjct: 10 LCFLCVLTLLYHQCSHCHEGGSHHHHGHNHGDHDHIHS 47


>sp|Q8B119|GLYC_PIRVV Pre-glycoprotein polyprotein GP complex
OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995)
GN=GPC PE=3 SV=1
Length = 510

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
Frame = +2

Query: 11 LCKSMAATTLGLQENATLQNRGGIHVDGAMGADVTFALGGKDTSEL----EDCTISGKIS 178
LC++ A L +Q N T ++GG V + A + +G + + +CT SGK S
Sbjct: 168 LCRTTAGAGLLIQYNLTTSDKGG-EVGRHLIASLAQIIGDNKAAWVGKCYNNCTSSGKCS 226

Query: 179 PPSCQTG 199
+C+ G
Sbjct: 227 LTNCEGG 233


>sp|Q554L3|Y5003_DICDI Putative uncharacterized protein DDB_G0275003
OS=Dictyostelium discoideum GN=DDB_G0275003 PE=4 SV=1
Length = 626

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
Frame = +3

Query: 42 DYRRMQPCR-IVEASMLMVPWELMLHLHLVAKTRQSLKIAQYQEKFHLQAAKQV 200
D +QP + I S + WE M H ++ T + LKI ++ K H Q K +
Sbjct: 384 DEEVIQPIQSIFRVSHCIKDWEEMCHSISISTTLKDLKIKEFCNKLHCQIWKSI 437


>sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M
OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1
Length = 2388

Score = 29.3 bits (64), Expect = 6.3
Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 1/80 (1%)
Frame = +2

Query: 44 LQENATLQNRGG-IHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGMNNATIA 220
LQ +RGG I D + +T G T I+PP +T N T
Sbjct: 1932 LQSTIIRNDRGGDILPDSTLEGQITNLSGNNSTIS---------INPPLPETNNNTTTTT 1982

Query: 221 AGGQPQEDEPTLTAGGGNDQ 280
QP++ P LT+ G+D+
Sbjct: 1983 TTTQPKK-SPILTSSNGSDK 2001


>sp|A0Q2E1|ANSME_CLONN Anaerobic sulfatase-maturating enzyme
OS=Clostridium novyi (strain NT) GN=NT01CX_0295 PE=3
SV=1
Length = 374

Score = 28.9 bits (63), Expect = 8.3
Identities = 15/41 (36%), Positives = 20/41 (48%)
Frame = +1

Query: 160 NIRKNFTSKLPNRYEQCHDCSWRPTPRR*AYSNCRWWE*PN 282
N+ KNF N +C +C+W P R S CR + PN
Sbjct: 301 NVTKNFIDSSLNHDVKCKNCNWYPLCR----SGCRRNKEPN 337


tr_hit_id A3V5T4
Definition tr|A3V5T4|A3V5T4_9RHOB VCBS OS=Loktanella vestfoldensis SKA53
Align length 72
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913007|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_D02.
(284 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A3V5T4|A3V5T4_9RHOB VCBS OS=Loktanella vestfoldensis SKA53 GN... 35 1.4
tr|A1DLH7|A1DLH7_NEOFI Putative uncharacterized protein OS=Neosa... 35 1.4
tr|B0TBX2|B0TBX2_HELMI Peptidase m23b, putative OS=Heliobacteriu... 35 1.9
tr|Q0AG23|Q0AG23_NITEC Major tail protein, putative OS=Nitrosomo... 34 3.2
tr|B0CET5|B0CET5_ACAM1 Type I secretion target repeat protein OS... 34 4.2
tr|A6GYT5|A6GYT5_FLAPJ Putative uncharacterized protein OS=Flavo... 33 5.5
tr|B5S057|B5S057_RALSO Putative calcium-binding hemolysin-like p... 33 7.2
tr|A3RZ38|A3RZ38_RALSO RTX family calcium-binding cytotoxins and... 33 7.2
tr|B3MBN1|B3MBN1_DROAN GF13311 (Fragment) OS=Drosophila ananassa... 33 7.2
tr|Q46EE4|Q46EE4_METBF Zinc-binding alcohol dehydrogenase OS=Met... 33 7.2
tr|Q92X83|Q92X83_RHIME Probable type I secretion target repeat p... 33 9.3
tr|B4WTS4|B4WTS4_9SYNE Type I secretion target GGXGXDXXX repeat ... 33 9.3
tr|A3T1A0|A3T1A0_9RHOB Type I secretion target repeat protein OS... 33 9.3
tr|A0YMZ8|A0YMZ8_9CYAN Hemolysin-type calcium-binding region pro... 33 9.3
tr|A8I4U7|A8I4U7_CHLRE Predicted protein OS=Chlamydomonas reinha... 33 9.3

>tr|A3V5T4|A3V5T4_9RHOB VCBS OS=Loktanella vestfoldensis SKA53
GN=SKA53_04203 PE=4 SV=1
Length = 1076

Score = 35.4 bits (80), Expect = 1.4
Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 2/72 (2%)
Frame = +2

Query: 74 GGIHVDGAMGADVTFALGGKDT--SELEDCTISGKISPPSCQTGMNNATIAAGGQPQEDE 247
G + G G ++ A G DT S D I G + G N TI G D+
Sbjct: 864 GNDTITGGSGTNIILAGAGNDTITSGTGDDIIMGGAGNDTITAGAGNDTIMGGA----DD 919

Query: 248 PTLTAGGGNDQI 283
T+TAG GND I
Sbjct: 920 DTITAGAGNDII 931


>tr|A1DLH7|A1DLH7_NEOFI Putative uncharacterized protein
OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 /
NRRL 181) GN=NFIA_049890 PE=4 SV=1
Length = 544

Score = 35.4 bits (80), Expect = 1.4
Identities = 20/59 (33%), Positives = 29/59 (49%)
Frame = +2

Query: 107 DVTFALGGKDTSELEDCTISGKISPPSCQTGMNNATIAAGGQPQEDEPTLTAGGGNDQI 283
D+ + GG +ELED +S ++ NNA +AAG P+ EP T G Q+
Sbjct: 100 DLNYDSGGSPLTELED--LSDEVDDSVSDLPSNNADVAAGKFPEHPEPNSTNDPGGRQL 156


>tr|B0TBX2|B0TBX2_HELMI Peptidase m23b, putative OS=Heliobacterium
modesticaldum (strain ATCC 51547 / Ice1) GN=Helmi_26200
PE=4 SV=1
Length = 297

Score = 35.0 bits (79), Expect = 1.9
Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
Frame = -3

Query: 279 WSFPPPAVRVGSS--SWGWPPAAIVALFIPVWQL 184
W PPP R GSS W W A +ALF +WQ+
Sbjct: 81 WGEPPPGRREGSSLRRWLWQTAISLALFAAIWQV 114


>tr|Q0AG23|Q0AG23_NITEC Major tail protein, putative OS=Nitrosomonas
eutropha (strain C91) GN=Neut_1463 PE=4 SV=1
Length = 238

Score = 34.3 bits (77), Expect = 3.2
Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 4/92 (4%)
Frame = +2

Query: 8 PLCKSMAATTLGLQENATLQNRGGIHVDGAMGAD----VTFALGGKDTSELEDCTISGKI 175
P ++ TLG+ NA N I + G D +TFA+G D ++L + G +
Sbjct: 56 PGLRTPGQATLGI--NADPDNASHIALHGLSQTDPAPVITFAVGWSDGTQLPTLRVKGTV 113

Query: 176 SPPSCQTGMNNATIAAGGQPQEDEPTLTAGGG 271
++ T+ AGG PT+T GG
Sbjct: 114 ---------DSITVTAGGNGYTGTPTVTITGG 136


>tr|B0CET5|B0CET5_ACAM1 Type I secretion target repeat protein
OS=Acaryochloris marina (strain MBIC 11017) GN=AM1_3194
PE=4 SV=1
Length = 760

Score = 33.9 bits (76), Expect = 4.2
Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 2/83 (2%)
Frame = +2

Query: 41 GLQENATLQNRGGIHV-DGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGMNNATI 217
G +N TL RGG + DG G DV + GGKD + G S + G + T+
Sbjct: 128 GENDNDTLYGRGGADLLDGGAGDDVLYGNGGKD-------VLYGYTGQDSLEGGNGHDTL 180

Query: 218 AAG-GQPQEDEPTLTAGGGNDQI 283
G G Q L G GND +
Sbjct: 181 DGGTGNDQ-----LWGGKGNDSL 198


>tr|A6GYT5|A6GYT5_FLAPJ Putative uncharacterized protein
OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC
49511) GN=FP1171 PE=4 SV=1
Length = 2795

Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 945 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1003

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1004 NTVTVTAVLNPVADSGTAPSTGG 1026



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 1044 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1102

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1103 NTVTVTAVLNPVADSGTAPSTGG 1125



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 1143 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1201

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1202 NTVTVTAVLNPVADSGTAPSTGG 1224



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 1341 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1399

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1400 NTVTVTAVLNPVADSGTAPSTGG 1422



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 1440 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1498

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1499 NTVTVTAVLNPVADSGTAPSTGG 1521



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 1737 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1795

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1796 NTVTVTAVLNPVADSGTAPSTGG 1818



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 1836 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 1894

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 1895 NTVTVTAVLNPVADSGTAPSTGG 1917



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 2034 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 2092

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 2093 NTVTVTAVLNPVADSGTAPSTGG 2115



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 2133 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 2191

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 2192 NTVTVTAVLNPVADSGTAPSTGG 2214



Score = 33.5 bits (75), Expect = 5.5
Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
Frame = +2

Query: 35 TLGLQENATLQNRG----GIHVDGAMGADVTFALGGKDTSELEDCTISGKISPPSCQTGM 202
TLG+ NAT+ G G+ ++ GA + A+G + K++P +C T +
Sbjct: 2331 TLGVSGNATIATSGVWPVGVTLNPTTGA-INVAVGTIPGVYPVTYQLCDKLTPQTCATVV 2389

Query: 203 NNATIAAGGQPQEDEPTLTAGGG 271
N T+ A P D T + GG
Sbjct: 2390 NTVTVTAVLNPVADSGTAPSTGG 2412


>tr|B5S057|B5S057_RALSO Putative calcium-binding hemolysin-like
protein (Partial sequence) (Fragment) OS=Ralstonia
solanacearum GN=RSIPO_04548 PE=4 SV=1
Length = 825

Score = 33.1 bits (74), Expect = 7.2
Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 2/83 (2%)
Frame = +2

Query: 35 TLGLQENATLQNRGGIHVDGAMGADVTFALGGKDT--SELEDCTISGKISPPSCQTGMNN 208
T LQ A+ G + G+ G+D+ +ALGG D + D + G + G N
Sbjct: 548 TADLQARASGGTDGADTLTGSSGSDIIYALGGNDAVYGQGGDDVLDGGAGNDTLYGGEGN 607

Query: 209 ATIAAGGQPQEDEPTLTAGGGND 277
+ G D L G GND
Sbjct: 608 DILRGGA----DNDNLYGGNGND 626


>tr|A3RZ38|A3RZ38_RALSO RTX family calcium-binding cytotoxins and
bacteriocins OS=Ralstonia solanacearum UW551
GN=RRSL_01432 PE=4 SV=1
Length = 1643

Score = 33.1 bits (74), Expect = 7.2
Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 2/83 (2%)
Frame = +2

Query: 35 TLGLQENATLQNRGGIHVDGAMGADVTFALGGKDT--SELEDCTISGKISPPSCQTGMNN 208
T LQ A+ G + G+ G+D+ +ALGG D + D + G + G N
Sbjct: 1032 TADLQARASGGTDGADTLTGSSGSDIIYALGGNDAVYGQGGDDVLDGGAGNDTLYGGEGN 1091

Query: 209 ATIAAGGQPQEDEPTLTAGGGND 277
+ G D L G GND
Sbjct: 1092 DILRGGA----DNDNLYGGNGND 1110


>tr|B3MBN1|B3MBN1_DROAN GF13311 (Fragment) OS=Drosophila ananassae
GN=GF13311 PE=4 SV=1
Length = 1063

Score = 33.1 bits (74), Expect = 7.2
Identities = 31/96 (32%), Positives = 40/96 (41%), Gaps = 17/96 (17%)
Frame = +2

Query: 38 LGLQENATLQNRG-GIHVDGAM-GADVTFALGGKD------TSELEDCTISGKIS----- 178
LG Q N +LQ G G+ V G M GA T G ++ L SG I+
Sbjct: 962 LGGQSNGSLQTNGSGLGVGGGMVGACNTLPHPGSSLHVGGISAALTSSVTSGNITIGAAQ 1021

Query: 179 ----PPSCQTGMNNATIAAGGQPQEDEPTLTAGGGN 274
P QT + T+ AGG + L+ GGGN
Sbjct: 1022 SLLTSPRSQTATYSTTLGAGGAGVQSPLLLSGGGGN 1057


>tr|Q46EE4|Q46EE4_METBF Zinc-binding alcohol dehydrogenase
OS=Methanosarcina barkeri (strain Fusaro / DSM 804)
GN=Mbar_A0771 PE=3 SV=1
Length = 353

Score = 33.1 bits (74), Expect = 7.2
Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
Frame = +2

Query: 80 IHVDGAMGADVT-FALGGKDTSELEDCTISGKISPPSCQTGM-----NNATIAAGGQPQE 241
+ V A+G +VT F +G + C +S + SC+ G NNATI G P+E
Sbjct: 69 VGVVAAVGKNVTKFKVGDRAGV---GCMVSSCMECESCKNGEEHHCDNNATIMTYGYPEE 125

Query: 242 DEPTLTAGGGNDQ 280
PT + GG Q
Sbjct: 126 SSPTGISQGGYSQ 138