BP913014
Clone id YMU001_000025_D11
Library
Length 621
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000025_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGGACAGATGATAGTCCAGATGGATTTAAGCCAGCTAAATTAAGCACAATGGATGGCTC
AGATAATGCTTCACCTCAAGCTCATGATTTATCTGGAAAGGCCATGGATGGCAGAATGGA
TGACGTTTGTGCTGGTGATACTGTCAGTGTGGAGGACTTGCGAGGTCTTAGCTTAATTAA
TTTCAAGCGTCTGCTAGGTCTTAAAGCGGATCAAGGAATGGCATCATCTTCTGCTGGAAG
TGGGACTCCTCGCTCCACTCTGACGACTCCGAGAACTAGTCAGCTCGATCTGTTATGGGC
TGAACGAAATAGCTTTGTAGAACAAGAAGATACTTCCCAGATCTACGAGCTTGCAGCCAT
TGCAAGGGAGATAGCAAGTAAAAGCTACTCTGAGGAGGGAGTCCTAGACACTCTTGGAGC
ATGCCTAGAGGAGTTGCATGATTTTCTAGCACGCAACAAGATTCCGGATCTTACCGTTGA
CACATTTGGCAAGCGCATTGAAAAACTTCTAACGGAAAAGAGCTATCTTTTCAGTAGCAC
TGGTGATGTCCGGAAGTCTGATTCTTTGAGTGGCTCCTTTGAGGATGACGGCATGTCAAC
TGATGATGGAGTGCAAAGCTT
■■Homology search results ■■ -
sp_hit_id Q8RG35
Definition sp|Q8RG35|UPP_FUSNN Uracil phosphoribosyltransferase OS=Fusobacterium nucleatum subsp. nucleatum
Align length 54
Score (bit) 33.5
E-value 0.91
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913014|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_D11.
(621 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8RG35|UPP_FUSNN Uracil phosphoribosyltransferase OS=Fusobact... 33 0.91
sp|Q85B60|YCF2_ADICA Protein ycf2 OS=Adiantum capillus-veneris G... 32 2.6
sp|Q7K480|BN3D1_DROME Probable methyltransferase bin3 OS=Drosoph... 31 5.9

>sp|Q8RG35|UPP_FUSNN Uracil phosphoribosyltransferase
OS=Fusobacterium nucleatum subsp. nucleatum GN=upp PE=3
SV=2
Length = 207

Score = 33.5 bits (75), Expect = 0.91
Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
Frame = +2

Query: 392 EEGVLDTLGACLEELHDFLAR--NKIPDLTVDTFGKRIEKLLTEKSYLFSSTGD 547
E+GV D + CL D +AR NK PD+ + T +I++ L E Y++ GD
Sbjct: 147 EQGVTDIIFMCLVAAPDGIARLLNKHPDVPIYT--AKIDQGLNENGYIYPGLGD 198


>sp|Q85B60|YCF2_ADICA Protein ycf2 OS=Adiantum capillus-veneris
GN=ycf2-A PE=2 SV=2
Length = 2104

Score = 32.0 bits (71), Expect = 2.6
Identities = 18/69 (26%), Positives = 39/69 (56%), Gaps = 2/69 (2%)
Frame = +2

Query: 359 IAREIASKSYSEEGVLDTLGACLEELHD--FLARNKIPDLTVDTFGKRIEKLLTEKSYLF 532
+++ I +++ ++ ++DT+ C+E+L D F NK+ + +D F + + E+ LF
Sbjct: 622 LSKMIVAEATRQKILIDTVDYCIEKLDDIDFEKLNKMDRIELDFFSSLSDGYIDEEILLF 681

Query: 533 SSTGDVRKS 559
+ + RKS
Sbjct: 682 KTILEERKS 690


>sp|Q7K480|BN3D1_DROME Probable methyltransferase bin3 OS=Drosophila
melanogaster GN=bin3 PE=1 SV=1
Length = 1367

Score = 30.8 bits (68), Expect = 5.9
Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
Frame = +2

Query: 5 TDDS---PDGFKPAKLSTMDGSDNASPQA--HDLSGKAMDGRMDD 124
TDDS P G + +T G ++SPQ HD G+ +DG MDD
Sbjct: 1302 TDDSNQLPGGSRRHVYATNCGESSSSPQVNHHDAVGEFVDGLMDD 1346


tr_hit_id Q9AUR3
Definition tr|Q9AUR3|Q9AUR3_ORYSA Putative uncharacterized protein OSJNBb0033N16.3 OS=Oryza sativa
Align length 203
Score (bit) 110.0
E-value 9.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913014|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_D11.
(621 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9AUR3|Q9AUR3_ORYSA Putative uncharacterized protein OSJNBb00... 110 9e-23
tr|Q10E10|Q10E10_ORYSJ Os03g0711800 protein OS=Oryza sativa subs... 110 9e-23
tr|Q10E09|Q10E09_ORYSJ Protein kinase, putative, expressed OS=Or... 110 9e-23
tr|A3AM04|A3AM04_ORYSJ Putative uncharacterized protein OS=Oryza... 110 9e-23
tr|A2XLA4|A2XLA4_ORYSI Putative uncharacterized protein OS=Oryza... 110 9e-23
tr|Q9MB45|Q9MB45_ARATH IRE homolog 1 (Fragment) OS=Arabidopsis t... 104 4e-21
tr|Q9LVI5|Q9LVI5_ARATH IRE homolog; protein kinase-like protein ... 104 4e-21
tr|Q8GZ40|Q8GZ40_ARATH Putative uncharacterized protein At3g1785... 104 4e-21
tr|A7PHB5|A7PHB5_VITVI Chromosome chr17 scaffold_16, whole genom... 97 8e-19
tr|A7NTE8|A7NTE8_VITVI Chromosome chr18 scaffold_1, whole genome... 93 1e-17
tr|Q94F38|Q94F38_ARATH At1g48490/T1N15_9 OS=Arabidopsis thaliana... 87 8e-16
tr|Q9MAJ4|Q9MAJ4_ARATH F27F5.23 OS=Arabidopsis thaliana PE=4 SV=1 81 4e-14
tr|Q0WLU7|Q0WLU7_ARATH Similar to IRE homolog 1 OS=Arabidopsis t... 81 4e-14
tr|A9TUB0|A9TUB0_PHYPA Predicted protein (Fragment) OS=Physcomit... 80 7e-14
tr|A9T694|A9T694_PHYPA Predicted protein (Fragment) OS=Physcomit... 80 1e-13
tr|A9TQ65|A9TQ65_PHYPA Predicted protein (Fragment) OS=Physcomit... 78 4e-13
tr|A9TWY7|A9TWY7_PHYPA Predicted protein (Fragment) OS=Physcomit... 70 1e-10
tr|A7QWR7|A7QWR7_VITVI Chromosome chr16 scaffold_207, whole geno... 69 3e-10
tr|Q9LP76|Q9LP76_ARATH T1N15.10 OS=Arabidopsis thaliana PE=4 SV=1 68 4e-10
tr|Q32YB5|Q32YB5_MEDTR Nodule-specific IRE-like protein OS=Medic... 63 1e-08
tr|Q9LE81|Q9LE81_ARATH IRE OS=Arabidopsis thaliana GN=IRE PE=4 SV=1 62 4e-08
tr|Q2QM12|Q2QM12_ORYSJ Os12g0621500 protein OS=Oryza sativa subs... 59 2e-07
tr|B8BN29|B8BN29_ORYSI Putative uncharacterized protein OS=Oryza... 59 2e-07
tr|A9PH62|A9PH62_POPTR Putative uncharacterized protein OS=Popul... 59 2e-07
tr|A3CJJ7|A3CJJ7_ORYSJ Putative uncharacterized protein OS=Oryza... 59 2e-07
tr|A5C7G4|A5C7G4_VITVI Putative uncharacterized protein OS=Vitis... 55 3e-06
tr|A5JZ31|A5JZ31_PLAVI Putative uncharacterized protein OS=Plasm... 38 0.42
tr|B4SAX5|B4SAX5_PELPB 5'-Nucleotidase domain protein OS=Pelodic... 37 1.2
tr|Q1E416|Q1E416_COCIM Putative uncharacterized protein OS=Cocci... 37 1.2
tr|B6Q7S2|B6Q7S2_PENMA Kinesin family protein OS=Penicillium mar... 37 1.2

>tr|Q9AUR3|Q9AUR3_ORYSA Putative uncharacterized protein
OSJNBb0033N16.3 OS=Oryza sativa GN=OSJNBb0033N16.3 PE=4
SV=1
Length = 1274

Score = 110 bits (274), Expect = 9e-23
Identities = 75/203 (36%), Positives = 106/203 (52%), Gaps = 1/203 (0%)
Frame = +2

Query: 14 SPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFKR 190
SPD K + S + SD SP+ D S + +D + D T+S++D++ L + K
Sbjct: 644 SPDVAKVSNSSINEESDGPSPKLSDWSRRGSADMLDYLQEADSTISLDDIKNLPSMTCKT 703

Query: 191 LLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIARE 370
G K+D GMA+SSA + +D+L A R++ E +D QI ELA IAR
Sbjct: 704 RFGPKSDHGMATSSAGSMTPRSPLTTPRSNHIDMLLAGRSAINESDDLPQIVELADIARC 763

Query: 371 IASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGDV 550
IA+ EE L L C+E+L + + R K LTV TFG RIEKL EK L + D+
Sbjct: 764 IATTPLDEERALSLLVTCIEDLQEIVNRRKHEALTVQTFGTRIEKLHREKYLLLCDSVDM 823

Query: 551 RKSDSLSGSFEDDGMSTDDGVQS 619
K DS S +++ DD V+S
Sbjct: 824 DKVDSASTVMDEE----DDVVRS 842


>tr|Q10E10|Q10E10_ORYSJ Os03g0711800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0711800 PE=4 SV=1
Length = 1267

Score = 110 bits (274), Expect = 9e-23
Identities = 75/203 (36%), Positives = 106/203 (52%), Gaps = 1/203 (0%)
Frame = +2

Query: 14 SPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFKR 190
SPD K + S + SD SP+ D S + +D + D T+S++D++ L + K
Sbjct: 637 SPDVAKVSNSSINEESDGPSPKLSDWSRRGSADMLDYLQEADSTISLDDIKNLPSMTCKT 696

Query: 191 LLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIARE 370
G K+D GMA+SSA + +D+L A R++ E +D QI ELA IAR
Sbjct: 697 RFGPKSDHGMATSSAGSMTPRSPLTTPRSNHIDMLLAGRSAINESDDLPQIVELADIARC 756

Query: 371 IASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGDV 550
IA+ EE L L C+E+L + + R K LTV TFG RIEKL EK L + D+
Sbjct: 757 IATTPLDEERALSLLVTCIEDLQEIVNRRKHEALTVQTFGTRIEKLHREKYLLLCDSVDM 816

Query: 551 RKSDSLSGSFEDDGMSTDDGVQS 619
K DS S +++ DD V+S
Sbjct: 817 DKVDSASTVMDEE----DDVVRS 835


>tr|Q10E09|Q10E09_ORYSJ Protein kinase, putative, expressed OS=Oryza
sativa subsp. japonica GN=LOC_Os03g50390 PE=4 SV=1
Length = 685

Score = 110 bits (274), Expect = 9e-23
Identities = 75/203 (36%), Positives = 106/203 (52%), Gaps = 1/203 (0%)
Frame = +2

Query: 14 SPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFKR 190
SPD K + S + SD SP+ D S + +D + D T+S++D++ L + K
Sbjct: 63 SPDVAKVSNSSINEESDGPSPKLSDWSRRGSADMLDYLQEADSTISLDDIKNLPSMTCKT 122

Query: 191 LLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIARE 370
G K+D GMA+SSA + +D+L A R++ E +D QI ELA IAR
Sbjct: 123 RFGPKSDHGMATSSAGSMTPRSPLTTPRSNHIDMLLAGRSAINESDDLPQIVELADIARC 182

Query: 371 IASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGDV 550
IA+ EE L L C+E+L + + R K LTV TFG RIEKL EK L + D+
Sbjct: 183 IATTPLDEERALSLLVTCIEDLQEIVNRRKHEALTVQTFGTRIEKLHREKYLLLCDSVDM 242

Query: 551 RKSDSLSGSFEDDGMSTDDGVQS 619
K DS S +++ DD V+S
Sbjct: 243 DKVDSASTVMDEE----DDVVRS 261


>tr|A3AM04|A3AM04_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_011826 PE=4 SV=1
Length = 1324

Score = 110 bits (274), Expect = 9e-23
Identities = 75/203 (36%), Positives = 106/203 (52%), Gaps = 1/203 (0%)
Frame = +2

Query: 14 SPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFKR 190
SPD K + S + SD SP+ D S + +D + D T+S++D++ L + K
Sbjct: 694 SPDVAKVSNSSINEESDGPSPKLSDWSRRGSADMLDYLQEADSTISLDDIKNLPSMTCKT 753

Query: 191 LLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIARE 370
G K+D GMA+SSA + +D+L A R++ E +D QI ELA IAR
Sbjct: 754 RFGPKSDHGMATSSAGSMTPRSPLTTPRSNHIDMLLAGRSAINESDDLPQIVELADIARC 813

Query: 371 IASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGDV 550
IA+ EE L L C+E+L + + R K LTV TFG RIEKL EK L + D+
Sbjct: 814 IATTPLDEERALSLLVTCIEDLQEIVNRRKHEALTVQTFGTRIEKLHREKYLLLCDSVDM 873

Query: 551 RKSDSLSGSFEDDGMSTDDGVQS 619
K DS S +++ DD V+S
Sbjct: 874 DKVDSASTVMDEE----DDVVRS 892


>tr|A2XLA4|A2XLA4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13249 PE=4 SV=1
Length = 1090

Score = 110 bits (274), Expect = 9e-23
Identities = 75/203 (36%), Positives = 106/203 (52%), Gaps = 1/203 (0%)
Frame = +2

Query: 14 SPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFKR 190
SPD K + S + SD SP+ D S + +D + D T+S++D++ L + K
Sbjct: 460 SPDVAKVSNSSINEESDGPSPKLSDWSRRGSADMLDYLQEADSTISLDDIKNLPSMTCKT 519

Query: 191 LLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIARE 370
G K+D GMA+SSA + +D+L A R++ E +D QI ELA IAR
Sbjct: 520 RFGPKSDHGMATSSAGSMTPRSPLTTPRSNHIDMLLAGRSAINESDDLPQIVELADIARC 579

Query: 371 IASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGDV 550
IA+ EE L L C+E+L + + R K LTV TFG RIEKL EK L + D+
Sbjct: 580 IATTPLDEERALSLLVTCIEDLQEIVNRRKHEALTVQTFGTRIEKLHREKYLLLCDSVDM 639

Query: 551 RKSDSLSGSFEDDGMSTDDGVQS 619
K DS S +++ DD V+S
Sbjct: 640 DKVDSASTVMDEE----DDVVRS 658


>tr|Q9MB45|Q9MB45_ARATH IRE homolog 1 (Fragment) OS=Arabidopsis
thaliana GN=IREH1 PE=4 SV=1
Length = 1023

Score = 104 bits (260), Expect = 4e-21
Identities = 69/204 (33%), Positives = 104/204 (50%), Gaps = 1/204 (0%)
Frame = +2

Query: 11 DSPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFK 187
+SPDG K + + SD SP+ D S K + +D D ++ ++DLRGL L++ +
Sbjct: 389 ESPDGMKVSNSHLTEESDVLSPRLSDWSRKGSEDMLDCFPEADNSIFMDDLRGLPLMSCR 448

Query: 188 RLLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIAR 367
G K+DQGM +SSA ++ + + +F +Q+D Q+ ELA IA+
Sbjct: 449 TRFGPKSDQGMTTSSASSMTPRSPIPTPRPDPIEQILGGKGTFHDQDDIPQMSELADIAK 508

Query: 368 EIASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGD 547
A ++ + L +CLE+L + R K LTV+TFG RIEKL+ EK D
Sbjct: 509 CAADAIPGDDQSIPFLLSCLEDLRVVIDRRKFDALTVETFGTRIEKLIREKYVHMCELMD 568

Query: 548 VRKSDSLSGSFEDDGMSTDDGVQS 619
K D LS ++D DD V+S
Sbjct: 569 DEKVDLLSTVIDEDAPLEDDVVRS 592


>tr|Q9LVI5|Q9LVI5_ARATH IRE homolog; protein kinase-like protein
OS=Arabidopsis thaliana PE=4 SV=1
Length = 1398

Score = 104 bits (260), Expect = 4e-21
Identities = 69/204 (33%), Positives = 104/204 (50%), Gaps = 1/204 (0%)
Frame = +2

Query: 11 DSPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFK 187
+SPDG K + + SD SP+ D S K + +D D ++ ++DLRGL L++ +
Sbjct: 765 ESPDGMKVSNSHLTEESDVLSPRLSDWSRKGSEDMLDCFPEADNSIFMDDLRGLPLMSCR 824

Query: 188 RLLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIAR 367
G K+DQGM +SSA ++ + + +F +Q+D Q+ ELA IA+
Sbjct: 825 TRFGPKSDQGMTTSSASSMTPRSPIPTPRPDPIEQILGGKGTFHDQDDIPQMSELADIAK 884

Query: 368 EIASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGD 547
A ++ + L +CLE+L + R K LTV+TFG RIEKL+ EK D
Sbjct: 885 CAADAIPGDDQSIPFLLSCLEDLRVVIDRRKFDALTVETFGTRIEKLIREKYVHMCELMD 944

Query: 548 VRKSDSLSGSFEDDGMSTDDGVQS 619
K D LS ++D DD V+S
Sbjct: 945 DEKVDLLSTVIDEDAPLEDDVVRS 968


>tr|Q8GZ40|Q8GZ40_ARATH Putative uncharacterized protein
At3g17850/MEB5_7 OS=Arabidopsis thaliana
GN=At3g17850/MEB5_7 PE=2 SV=1
Length = 1296

Score = 104 bits (260), Expect = 4e-21
Identities = 69/204 (33%), Positives = 104/204 (50%), Gaps = 1/204 (0%)
Frame = +2

Query: 11 DSPDGFKPAKLSTMDGSDNASPQAHDLSGKAMDGRMDDVCAGD-TVSVEDLRGLSLINFK 187
+SPDG K + + SD SP+ D S K + +D D ++ ++DLRGL L++ +
Sbjct: 662 ESPDGMKVSNSHLTEESDVLSPRLSDWSRKGSEDMLDCFPEADNSIFMDDLRGLPLMSCR 721

Query: 188 RLLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIAR 367
G K+DQGM +SSA ++ + + +F +Q+D Q+ ELA IA+
Sbjct: 722 TRFGPKSDQGMTTSSASSMTPRSPIPTPRPDPIEQILGGKGTFHDQDDIPQMSELADIAK 781

Query: 368 EIASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEKSYLFSSTGD 547
A ++ + L +CLE+L + R K LTV+TFG RIEKL+ EK D
Sbjct: 782 CAADAIPGDDQSIPFLLSCLEDLRVVIDRRKFDALTVETFGTRIEKLIREKYVHMCELMD 841

Query: 548 VRKSDSLSGSFEDDGMSTDDGVQS 619
K D LS ++D DD V+S
Sbjct: 842 DEKVDLLSTVIDEDAPLEDDVVRS 865


>tr|A7PHB5|A7PHB5_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017880001
PE=4 SV=1
Length = 1246

Score = 97.1 bits (240), Expect = 8e-19
Identities = 61/163 (37%), Positives = 87/163 (53%)
Frame = +2

Query: 131 AGDTVSVEDLRGLSLINFKRLLGLKADQGMASSSAXXXXXXXXXXXXXXSQLDLLWAERN 310
A + V V+DL+G ++ K G K+DQGM +SSA SQ+DLL A +
Sbjct: 673 ADNYVFVDDLKGFPSMSCKTRFGPKSDQGMTTSSAGSMTPRSPLLTPRTSQIDLLLAGKG 732

Query: 311 SFVEQEDTSQIYELAAIAREIASKSYSEEGVLDTLGACLEELHDFLARNKIPDLTVDTFG 490
++ E +D Q+ ELA I+R A+ S ++ + L CLE+L + R K+ LTV+TFG
Sbjct: 733 AYSEHDDLPQMNELADISRCAANASLHDDHSMSILLGCLEDLRVVIDRRKLDALTVETFG 792

Query: 491 KRIEKLLTEKSYLFSSTGDVRKSDSLSGSFEDDGMSTDDGVQS 619
RIEKL+ EK D K D S ++D DD V+S
Sbjct: 793 TRIEKLIREKYLQLCELVDDEKVDITSTVIDEDAPLEDDVVRS 835


>tr|A7NTE8|A7NTE8_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014639001
PE=4 SV=1
Length = 657

Score = 92.8 bits (229), Expect = 1e-17
Identities = 55/154 (35%), Positives = 76/154 (49%)
Frame = +2

Query: 59 SDNASPQAHDLSGKAMDGRMDDVCAGDTVSVEDLRGLSLINFKRLLGLKADQGMASSSAX 238
S+ SP+ + K ++G +D+ DT ++D + +N K G K Q A SS
Sbjct: 498 SEGCSPKISEWRNKGVEGMFEDLHEMDTACIDDSYLTNPLNLKGHWGTKLSQYGAPSSTG 557

Query: 239 XXXXXXXXXXXXXSQLDLLWAERNSFVEQEDTSQIYELAAIAREIASKSYSEEGVLDTLG 418
DL W E N+ + ED Q+ +LA IAR +A S+EG D L
Sbjct: 558 SMTSMSSTNTPRAGHFDLFWLEHNNPSKLEDVQQMADLADIARCVAGTDLSKEGSCDFLL 617

Query: 419 ACLEELHDFLARNKIPDLTVDTFGKRIEKLLTEK 520
AC+E+L D L K+ L +DTFG RIE LL EK
Sbjct: 618 ACMEDLQDVLQNTKLKSLVIDTFGGRIENLLREK 651