BP913020 [AcEST]

BP913020
Clone id	YMU001_000025_E06
Library	YMU01
Length	247
Definition	Adiantum capillus-veneris mRNA. clone: YMU001_000025_E06.
Accession	BP913020
Tissue type	prothallium
Developmental stage	-
Contig ID	-
Sequence	GCTACTTATGACATGGCAACACTGTACTGACAGTGTCACGAAGACGTGGCAACTTTTAAC TATGTCACGAGGACGTGGCAACTGCCAACTTTGGTTGTTGGTTTCTTTCCAATGATGTAG GTATTATTTTTGAGACCCTCTTTTAGAAGTTGCAAATGGTCAGACATTGTATGACCAATG TGAACAATAGTTTCACTCGTAGACGGGAAGTGGGTCGGCACTGGAATTTGTATAGTAAGA GGATGTC
■■Homology search results ■■	-
Swiss-Prot (release 56.9)	Link to BlastX Result : Swiss-Prot
sp_hit_id	-
Definition	No hits.
Align length	-
Score (bit)	-
E-value	-
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP913020\|Adiantum capillus-veneris mRNA, clone: YMU001_000025_E06. (247 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..................................................done *** No hits found ****
TrEMBL (release 39.9)	Link to BlastX Result : TrEMBL
tr_hit_id	A5K7U0
Definition	tr\|A5K7U0\|A5K7U0_PLAVI Myosin PfM-C, putative OS=Plasmodium vivax
Align length	34
Score (bit)	33.5
E-value	5.5
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP913020\|Adiantum capillus-veneris mRNA, clone: YMU001_000025_E06. (247 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tr\|A5K7U0\|A5K7U0_PLAVI Myosin PfM-C, putative OS=Plasmodium viva... 33 5.5 >tr\|A5K7U0\|A5K7U0_PLAVI Myosin PfM-C, putative OS=Plasmodium vivax GN=PVX_082400 PE=4 SV=1 Length = 1978 Score = 33.5 bits (75), Expect = 5.5 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 203 STSETIVHIGHTMSDHLQLLKEGLKNNTYIIGKK 102 S+ ++I + H + H QLLKE L +N+YI G K Sbjct: 1584 SSFKSICGVTHKKNPHAQLLKESLPHNSYIYGSK 1617