BP913022
Clone id YMU001_000025_E08
Library
Length 321
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000025_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTCATTCTTATCTTCTGGCAACCCTTCAGCTGAAGCTCCTCCATTCAAGATTTGTTCTT
GCTGAGCCTTCATGGACCCATGCTGTTTTCTGAGAAGAGGACTGCTGCTATGTATAGTCT
GTCGGATAGGCTGCCCTCCGCCGGCCTTATTTGGAGAAGGAACATGACCTATTCGCATAT
CTTGGATGGACTGCCAAATAGGCTGCTTTTGAGGAGTTTGGGCTCTTATTATGGGCTGAT
TCTCTCTTTTAACAAAAGCAGCGGATACACCAGCACTTCCAGAAGGGAAACGTAACAACT
TCCTATCACCATCGACCTCAA
■■Homology search results ■■ -
sp_hit_id A7MIC1
Definition sp|A7MIC1|RAPA_ENTS8 RNA polymerase-associated protein rapA OS=Enterobacter sakazakii (strain ATCC BAA-894)
Align length 75
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913022|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_E08.
(321 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A7MIC1|RAPA_ENTS8 RNA polymerase-associated protein rapA OS=E... 31 1.7
sp|Q6C908|PAN1_YARLI Actin cytoskeleton-regulatory complex prote... 30 2.8
sp|A6T4J7|RAPA_KLEP7 RNA polymerase-associated protein rapA OS=K... 30 3.7
sp|Q5RB75|NUDC3_PONAB NudC domain-containing protein 3 OS=Pongo ... 30 4.8
sp|Q96G97|BSCL2_HUMAN Seipin OS=Homo sapiens GN=BSCL2 PE=1 SV=2 30 4.8
sp|Q7UDT5|RAPA_SHIFL RNA polymerase-associated protein rapA OS=S... 29 6.3
sp|Q0T8D8|RAPA_SHIF8 RNA polymerase-associated protein rapA OS=S... 29 6.3
sp|Q5KKY3|PFS2_CRYNE Polyadenylation factor subunit 2 OS=Cryptoc... 29 6.3
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium disc... 29 6.3
sp|Q09314|YQT2_CAEEL Uncharacterized protein F25B5.2 OS=Caenorha... 29 8.2
sp|P58295|SC6A5_RAT Sodium- and chloride-dependent glycine trans... 29 8.2
sp|Q4R6P2|RWD2A_MACFA RWD domain-containing protein 2A OS=Macaca... 29 8.2
sp|Q9UIY3|RWD2A_HUMAN RWD domain-containing protein 2A OS=Homo s... 29 8.2
sp|Q32K36|RAPA_SHIDS RNA polymerase-associated protein rapA OS=S... 29 8.2
sp|Q326H6|RAPA_SHIBS RNA polymerase-associated protein rapA OS=S... 29 8.2
sp|Q1RGE0|RAPA_ECOUT RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|P60240|RAPA_ECOLI RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|B1IRB9|RAPA_ECOLC RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|Q8FL92|RAPA_ECOL6 RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|Q0TLT1|RAPA_ECOL5 RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|A1A7A6|RAPA_ECOK1 RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|A7ZW09|RAPA_ECOHS RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|P60241|RAPA_ECO57 RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|A7ZHF0|RAPA_ECO24 RNA polymerase-associated protein rapA OS=E... 29 8.2
sp|P50899|GUXB_CELFI Exoglucanase B OS=Cellulomonas fimi GN=cbhB... 29 8.2
sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing prot... 29 8.2
sp|P93022|ARFG_ARATH Auxin response factor 7 OS=Arabidopsis thal... 29 8.2

>sp|A7MIC1|RAPA_ENTS8 RNA polymerase-associated protein rapA
OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=rapA
PE=3 SV=1
Length = 968

Score = 31.2 bits (69), Expect = 1.7
Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 8/75 (10%)
Frame = -3

Query: 214 PQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSMKAQQEQ------ 53
P + I+ S+ + IG++ +P G + Q RKQH +KAQ EQ
Sbjct: 637 PTGRAIYDSVYEQLIGYLAAPENTEGFDALIQAC-------RKQHDELKAQLEQGRDRLL 689

Query: 52 --ILNGGASAEGLPE 14
NGG A+ L +
Sbjct: 690 EIHSNGGEKAQQLAD 704


>sp|Q6C908|PAN1_YARLI Actin cytoskeleton-regulatory complex protein
PAN1 OS=Yarrowia lipolytica GN=PAN1 PE=3 SV=1
Length = 1634

Score = 30.4 bits (67), Expect = 2.8
Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 3/80 (3%)
Frame = -3

Query: 265 SAAFVKRENQPIIRAQTP---QKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPL 95
S + + QP I P Q+ Q +Q G+ P ++ GG P++ + +PL
Sbjct: 387 STGYPMQAMQPQITGGMPLQQQRTGPMQPLQQQSTGYAPLQSQLTGGAPLQSQLTGGAPL 446

Query: 94 LRKQHGSMKAQQEQILNGGA 35
+ G Q + L GGA
Sbjct: 447 QSQLTGGAPLQSQ--LTGGA 464


>sp|A6T4J7|RAPA_KLEP7 RNA polymerase-associated protein rapA
OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC
700721 / MGH 78578) GN=rapA PE=3 SV=1
Length = 968

Score = 30.0 bits (66), Expect = 3.7
Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 8/79 (10%)
Frame = -3

Query: 214 PQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSMKAQQEQ------ 53
P + ++ S+ D I ++ +P G + ++ R+QH ++KAQ EQ
Sbjct: 637 PTGRTVYDSVHDELINYLAAPESIDGFDDLIKSC-------RQQHDALKAQLEQGRDRLL 689

Query: 52 --ILNGGASAEGLPEDKNE 2
NGG A+ L E E
Sbjct: 690 EIHSNGGEKAQALAESIEE 708


>sp|Q5RB75|NUDC3_PONAB NudC domain-containing protein 3 OS=Pongo
abelii GN=NUDCD3 PE=2 SV=1
Length = 361

Score = 29.6 bits (65), Expect = 4.8
Identities = 18/78 (23%), Positives = 35/78 (44%)
Frame = -3

Query: 250 KRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSM 71
+ E + A +K+P+ +Q++ I S + GG Q + + + P+ HGS+
Sbjct: 92 EEEEAKTVSAAAAEKEPVPVPVQEIEID---STTELGGRQEVEK-VQPPGPVKEMAHGSL 147

Query: 70 KAQQEQILNGGASAEGLP 17
+A+ + G A P
Sbjct: 148 EAEAPGAVAGAAEVPREP 165


>sp|Q96G97|BSCL2_HUMAN Seipin OS=Homo sapiens GN=BSCL2 PE=1 SV=2
Length = 400

Score = 29.6 bits (65), Expect = 4.8
Identities = 16/68 (23%), Positives = 30/68 (44%), Gaps = 5/68 (7%)
Frame = -3

Query: 286 PSGSAGVSAAFVKRENQPI-----IRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIR 122
PSG+ G + K + QP+ + + W+ + ++P+P A P+
Sbjct: 319 PSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAALLTEANLPAPAPASASAPVL 378

Query: 121 QTIHSSSP 98
+T+ SS P
Sbjct: 379 ETLGSSEP 386


>sp|Q7UDT5|RAPA_SHIFL RNA polymerase-associated protein rapA
OS=Shigella flexneri GN=rapA PE=3 SV=3
Length = 968

Score = 29.3 bits (64), Expect = 6.3
Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 8/79 (10%)
Frame = -3

Query: 214 PQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSMKAQQEQ------ 53
P + I+ S+ + I ++ SP++ G + ++ R+QH ++KAQ EQ
Sbjct: 637 PTGRTIYDSVYNDLINYLASPDQTEGFDDLIKSC-------REQHEALKAQLEQGRDRLL 689

Query: 52 --ILNGGASAEGLPEDKNE 2
NGG A+ L E E
Sbjct: 690 EIHSNGGEKAQALAESIEE 708


>sp|Q0T8D8|RAPA_SHIF8 RNA polymerase-associated protein rapA
OS=Shigella flexneri serotype 5b (strain 8401) GN=rapA
PE=3 SV=1
Length = 968

Score = 29.3 bits (64), Expect = 6.3
Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 8/79 (10%)
Frame = -3

Query: 214 PQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSMKAQQEQ------ 53
P + I+ S+ + I ++ SP++ G + ++ R+QH ++KAQ EQ
Sbjct: 637 PTGRTIYDSVYNDLINYLASPDQTEGFDDLIKSC-------REQHEALKAQLEQGRDRLL 689

Query: 52 --ILNGGASAEGLPEDKNE 2
NGG A+ L E E
Sbjct: 690 EIHSNGGEKAQALAESIEE 708


>sp|Q5KKY3|PFS2_CRYNE Polyadenylation factor subunit 2
OS=Cryptococcus neoformans GN=PFS2 PE=3 SV=1
Length = 712

Score = 29.3 bits (64), Expect = 6.3
Identities = 28/99 (28%), Positives = 37/99 (37%), Gaps = 5/99 (5%)
Frame = -3

Query: 286 PSGSAGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAG---GGQ--PIR 122
PSG G+ A V P R TP P P G GGQ R
Sbjct: 499 PSGLPGLGAPNVHAGTPPS-RVSTPSSMG------------PPGPGAQGQAQGGQFPRGR 545

Query: 121 QTIHSSSPLLRKQHGSMKAQQEQILNGGASAEGLPEDKN 5
+ S + +LR HGS ++ NGG G+ D++
Sbjct: 546 SALPSQNDMLRHNHGSRGGFADRDRNGGGDRGGMDRDRD 584


>sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium
discoideum GN=myoB PE=1 SV=2
Length = 1111

Score = 29.3 bits (64), Expect = 6.3
Identities = 21/84 (25%), Positives = 34/84 (40%)
Frame = -3

Query: 286 PSGSAGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHS 107
P SAG + QP + Q++P+ Q Q +P P + GG +P+
Sbjct: 939 PQQSAGRGRGMPQGAGQPQPQQPQQQQRPMPQPQQGGGARPMPQPQQGGGARPMGAPQQG 998

Query: 106 SSPLLRKQHGSMKAQQEQILNGGA 35
+P Q G+ + + GGA
Sbjct: 999 GAP----QQGAGRQLPQPTQQGGA 1018


>sp|Q09314|YQT2_CAEEL Uncharacterized protein F25B5.2
OS=Caenorhabditis elegans GN=F25B5.2 PE=2 SV=1
Length = 757

Score = 28.9 bits (63), Expect = 8.2
Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 12/88 (13%)
Frame = -3

Query: 283 SGSAGVSAAFVKRENQPIIR-------AQTPQKQP-----IWQSIQDMRIGHVPSPNKAG 140
S S G ++ F P++R P+ Q +++S+ + + VP+ G
Sbjct: 168 SASIGSTSVFCTPSRNPLMRNGLRMSTRSVPENQDDMPPALFRSLCNSAVRRVPTSKSEG 227

Query: 139 GGQPIRQTIHSSSPLLRKQHGSMKAQQE 56
GG P+R+++ S ++K++ S K ++
Sbjct: 228 GGTPMRRSMRMS---IQKRNLSSKNMED 252


tr_hit_id B3M6Q6
Definition tr|B3M6Q6|B3M6Q6_DROAN GF24861 OS=Drosophila ananassae
Align length 77
Score (bit) 38.5
E-value 0.17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913022|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_E08.
(321 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3M6Q6|B3M6Q6_DROAN GF24861 OS=Drosophila ananassae GN=GF2486... 39 0.17
tr|A1D4P5|A1D4P5_NEOFI C2H2 finger domain protein, putative OS=N... 36 1.1
tr|Q4WK49|Q4WK49_ASPFU C2H2 finger domain protein, putative OS=A... 35 1.4
tr|B0XN90|B0XN90_ASPFC C2H2 finger domain protein, putative OS=A... 35 1.4
tr|B4M5K8|B4M5K8_DROVI GJ10598 OS=Drosophila virilis GN=GJ10598 ... 35 2.4
tr|Q5KAV6|Q5KAV6_CRYNE Expressed protein (Putative uncharacteriz... 35 2.4
tr|Q5B609|Q5B609_EMENI Putative uncharacterized protein OS=Emeri... 34 3.2
tr|A7AW59|A7AW59_BABBO Putative uncharacterized protein OS=Babes... 33 5.4
tr|O81990|O81990_HORVU Putative transcription repressor HOTR OS=... 33 7.1
tr|Q38CY5|Q38CY5_9TRYP Putative uncharacterized protein OS=Trypa... 33 7.1
tr|B4H6V2|B4H6V2_DROPE GL22093 OS=Drosophila persimilis GN=GL220... 33 7.1
tr|Q0CR46|Q0CR46_ASPTN Putative uncharacterized protein OS=Asper... 33 9.2
tr|A1CRT6|A1CRT6_ASPCL C2H2 finger domain protein, putative OS=A... 33 9.2

>tr|B3M6Q6|B3M6Q6_DROAN GF24861 OS=Drosophila ananassae GN=GF24861
PE=4 SV=1
Length = 2205

Score = 38.5 bits (88), Expect = 0.17
Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)
Frame = -3

Query: 232 IIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPL-----LRKQHGSMK 68
II+ QP+ S R H+ SP+ + G P+ + ++SS P+ +R+++ S
Sbjct: 750 IIKPDVQDTQPVAPS----RAAHLQSPSSSADGSPLHRGVYSSPPVGVVSPIRRRNSSSN 805

Query: 67 AQQEQILNGGASAEGLP 17
+ QEQ GG SA+ P
Sbjct: 806 SVQEQ-SGGGGSAKTTP 821


>tr|A1D4P5|A1D4P5_NEOFI C2H2 finger domain protein, putative
OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 /
NRRL 181) GN=NFIA_020960 PE=4 SV=1
Length = 440

Score = 35.8 bits (81), Expect = 1.1
Identities = 26/88 (29%), Positives = 40/88 (45%)
Frame = -3

Query: 280 GSAGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSS 101
G GV ++ NQ +I AQ Q + Q++ P P GGQP ++
Sbjct: 87 GMEGVPNDVIQSHNQRVI-AQFQQAEAERQAVTGN-----PPPGAGSGGQPAKRPKLEDV 140

Query: 100 PLLRKQHGSMKAQQEQILNGGASAEGLP 17
L+K+ KA++ +I GG+S E P
Sbjct: 141 SDLKKRLAEHKAKKAEIAAGGSSGEATP 168


>tr|Q4WK49|Q4WK49_ASPFU C2H2 finger domain protein, putative
OS=Aspergillus fumigatus GN=AFUA_1G03710 PE=4 SV=1
Length = 433

Score = 35.4 bits (80), Expect = 1.4
Identities = 26/88 (29%), Positives = 40/88 (45%)
Frame = -3

Query: 280 GSAGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSS 101
G GV ++ NQ +I AQ Q + Q++ P P GGQP ++
Sbjct: 87 GMEGVPDDVIQSHNQRVI-AQFQQAEAERQAVTGN-----PPPGAGSGGQPSKRPKLEDV 140

Query: 100 PLLRKQHGSMKAQQEQILNGGASAEGLP 17
L+K+ KA++ +I GG+S E P
Sbjct: 141 SDLKKRLAEHKARKAEIAAGGSSGEATP 168


>tr|B0XN90|B0XN90_ASPFC C2H2 finger domain protein, putative
OS=Aspergillus fumigatus (strain CEA10 / CBS 144.89 /
FGSC A1163) GN=AFUB_004120 PE=4 SV=1
Length = 442

Score = 35.4 bits (80), Expect = 1.4
Identities = 26/88 (29%), Positives = 40/88 (45%)
Frame = -3

Query: 280 GSAGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSS 101
G GV ++ NQ +I AQ Q + Q++ P P GGQP ++
Sbjct: 87 GMEGVPDDVIQSHNQRVI-AQFQQAEAERQAVTGN-----PPPGAGSGGQPSKRPKLEDV 140

Query: 100 PLLRKQHGSMKAQQEQILNGGASAEGLP 17
L+K+ KA++ +I GG+S E P
Sbjct: 141 SDLKKRLAEHKARKAEIAAGGSSGEATP 168


>tr|B4M5K8|B4M5K8_DROVI GJ10598 OS=Drosophila virilis GN=GJ10598
PE=4 SV=1
Length = 579

Score = 34.7 bits (78), Expect = 2.4
Identities = 19/66 (28%), Positives = 32/66 (48%)
Frame = -3

Query: 250 KRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSM 71
+++ P+ PQ+Q Q I +G SP + G +QT H +SP ++Q
Sbjct: 184 QQQQPPLQHLPPPQQQQQQQQITTTPVGSALSPAQTPTGPTAQQTQHLTSPHHQQQQQQQ 243

Query: 70 KAQQEQ 53
+ QQ+Q
Sbjct: 244 QQQQQQ 249


>tr|Q5KAV6|Q5KAV6_CRYNE Expressed protein (Putative uncharacterized
protein) OS=Cryptococcus neoformans GN=CNBJ3180 PE=4
SV=1
Length = 338

Score = 34.7 bits (78), Expect = 2.4
Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 9/69 (13%)
Frame = -2

Query: 242 ESAHNKSPN-------SSKAAYLAVHPRYANRSCSFSK*GRRRA--AYPTDYT*QQSSSQ 90
++AH K N ++ + A+HPRY + + S GRR A PTD + SS
Sbjct: 184 DAAHRKGSNPLIAVSEDAELSSFAIHPRYRSSATSIPTPGRRSAWLPSPTDMSSLYSSRN 243

Query: 89 KTAWVHEGS 63
++ HEGS
Sbjct: 244 QSIASHEGS 252


>tr|Q5B609|Q5B609_EMENI Putative uncharacterized protein
OS=Emericella nidulans GN=AN4021.2 PE=4 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 3.2
Identities = 26/88 (29%), Positives = 42/88 (47%)
Frame = -3

Query: 280 GSAGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSS 101
G GV ++ NQ +I AQ Q + Q+I G+ PS + GQP ++ +
Sbjct: 87 GMEGVPEDAIQSHNQRVI-AQFQQSEAERQAIT----GNPPSGASSSSGQPAKKPKVENI 141

Query: 100 PLLRKQHGSMKAQQEQILNGGASAEGLP 17
L+K+ KA++ + GG+S E P
Sbjct: 142 SDLKKRLAEHKAKKAEARAGGSSGEATP 169


>tr|A7AW59|A7AW59_BABBO Putative uncharacterized protein OS=Babesia
bovis GN=BBOV_I002040 PE=4 SV=1
Length = 326

Score = 33.5 bits (75), Expect = 5.4
Identities = 12/32 (37%), Positives = 23/32 (71%)
Frame = -3

Query: 193 QSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSP 98
++++D+ + +VP+ N A G I++TIH +SP
Sbjct: 245 EAVEDLELSYVPTENIAKGDDSIQRTIHENSP 276


>tr|O81990|O81990_HORVU Putative transcription repressor HOTR
OS=Hordeum vulgare GN=Hotr1 PE=4 SV=1
Length = 548

Score = 33.1 bits (74), Expect = 7.1
Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 4/57 (7%)
Frame = -3

Query: 217 TPQKQPIWQ----SIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPLLRKQHGSMKAQQ 59
T K+P WQ +M+IG P+ ++A G H P RK +KAQ+
Sbjct: 383 TNAKEPSWQRNSFKANEMKIGEAPTEDEAYGTSHAESQFHEDEPCGRKWFERLKAQK 439


>tr|Q38CY5|Q38CY5_9TRYP Putative uncharacterized protein
OS=Trypanosoma brucei GN=Tb09.244.2710 PE=4 SV=1
Length = 418

Score = 33.1 bits (74), Expect = 7.1
Identities = 27/89 (30%), Positives = 40/89 (44%)
Frame = -3

Query: 274 AGVSAAFVKRENQPIIRAQTPQKQPIWQSIQDMRIGHVPSPNKAGGGQPIRQTIHSSSPL 95
A + A ++RE+Q + R++TPQ + QS + R G+P + SPL
Sbjct: 279 AQAALARIRREHQRLQRSRTPQGRIEHQSEKSTRQRSRFDTPPVVRGRPTSRGGARDSPL 338

Query: 94 LRKQHGSMKAQQEQILNGGASAEGLPEDK 8
LR+ K N AS+EGL K
Sbjct: 339 LRRLSSGRKQTHCMPRNRSASSEGLTVTK 367