BP913056
Clone id YMU001_000026_A02
Library
Length 447
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000026_A02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAGAGGAGAGAGGATTCTTGCGTATAGAGCTGAAGATGCTTTGAGAGTCATGCAATGTT
TGAGCAGACAGGCTGCGAGTGCTTATATGGAGGCTGAAGAGATTTTGTCCAGTCTGAGCA
CTGAACAAAGATTGTCACAATCAATGGCTGCTGTCCTAGATGAAGGGAAAGAGAACATTC
TATCAGCTGGGGATCATGGAAATGATTGGTTTTCAGTCTCTCCCGGATGCACACTGGTAG
ATATGTCATCGTGGAACATCCCATCTCAAATGACGCCAGCTCGCAGTGTTCATCAGAGAC
AAAGCTTTGAAAGTCCATCCATGTATTTGCTACGGGAGTATCGTTGATAGCATTGTCAAG
AAAATTTCTTGGTTTAACCCTCAACTACAAAGACCTTGTTGTCAGTGAACTTCTCTTTCA
CTCTCCCCAAGGTGATTACTATCTGTG
■■Homology search results ■■ -
sp_hit_id A1A4S6
Definition sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens
Align length 61
Score (bit) 30.8
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913056|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_A02.
(447 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo s... 31 2.7
sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 OS=Nitros... 30 4.6
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus mus... 29 8.0

>sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo
sapiens GN=ARHGAP10 PE=1 SV=1
Length = 786

Score = 30.8 bits (68), Expect = 2.7
Identities = 18/61 (29%), Positives = 26/61 (42%)
Frame = +3

Query: 105 LSSLSTEQRLSQSMAAVLDEGKENILSAGDHGNDWFSVSPGCTLVDMSSWNIPSQMTPAR 284
L SLS+ ++ ++ K ++L+ G DW S PG T M W P T
Sbjct: 638 LDSLSSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTS 697

Query: 285 S 287
S
Sbjct: 698 S 698


>sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2
OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1
Length = 888

Score = 30.0 bits (66), Expect = 4.6
Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 6/94 (6%)
Frame = +3

Query: 18 LAYRAEDALRVMQCLSRQAASAYMEAEEILSSLSTEQRLSQSMAAVLDEGKENILSAGD- 194
+A RAE+A + + ++RQAA + E+ ++ + + + V + G E +G
Sbjct: 138 IALRAEEARKRSELMARQAAELKEKQEKRRQQVTAQTEVKKESTQVQEPGSETAAVSGSV 197

Query: 195 -----HGNDWFSVSPGCTLVDMSSWNIPSQMTPA 281
+ +V+P T+ + +Q TPA
Sbjct: 198 AATQPESTETAAVTPSATI------TVTTQTTPA 225


>sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus
musculus GN=Smarcc1 PE=1 SV=2
Length = 1104

Score = 29.3 bits (64), Expect = 8.0
Identities = 17/44 (38%), Positives = 22/44 (50%)
Frame = -1

Query: 348 INDTPVANTWMDFQSFVSDEHCELASFEMGCSTMTYLPVCIRER 217
I DT V N WM+ + + DE+ + SF ST PV ER
Sbjct: 269 ILDTDVFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPER 312


tr_hit_id O65527
Definition tr|O65527|O65527_ARATH Putative uncharacterized protein F4D11.60 (Putative uncharacterized protein AT4g32740) OS=Arabidopsis thaliana
Align length 107
Score (bit) 40.8
E-value 0.033
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913056|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_A02.
(447 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O65527|O65527_ARATH Putative uncharacterized protein F4D11.60... 41 0.033
tr|Q7XJ57|Q7XJ57_ARATH At4g32740 OS=Arabidopsis thaliana PE=2 SV=1 40 0.044
tr|A7P5B2|A7P5B2_VITVI Chromosome chr4 scaffold_6, whole genome ... 34 3.1
tr|Q948S5|Q948S5_TOBAC Myb OS=Nicotiana tabacum GN=NtmybA2 PE=2 ... 34 4.1
tr|A0YZW7|A0YZW7_9CYAN L-sorbosone dehydrogenase OS=Lyngbya sp. ... 33 5.3
tr|Q948S6|Q948S6_TOBAC Myb OS=Nicotiana tabacum GN=NtmybA1 PE=2 ... 33 5.3
tr|B5WGT3|B5WGT3_9BURK NAD-dependent epimerase/dehydratase OS=Bu... 33 7.0
tr|Q8X1C0|Q8X1C0_USTMA Dkh6 (Putative uncharacterized protein) O... 33 9.1

>tr|O65527|O65527_ARATH Putative uncharacterized protein F4D11.60
(Putative uncharacterized protein AT4g32740)
OS=Arabidopsis thaliana GN=F4D11.60 PE=2 SV=1
Length = 235

Score = 40.8 bits (94), Expect = 0.033
Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 1/107 (0%)
Frame = +3

Query: 27 RAEDALRVMQCLSRQAASAYMEAEEILSSLSTEQRLSQSMAAVLDEGKENILSAGDHGND 206
R+ DA+ +M+ LS +A+AY +A E+L + + E L + +GKEN D +
Sbjct: 134 RSYDAIGLMKHLSEHSATAYADALEVLGNDTPESILKKRQLNKSIQGKENQHQPHDQLGN 193

Query: 207 WFSVSPGCTLVDMSSWNIPSQ-MTPARSVHQRQSFESPSMYLLREYR 344
V C +D S P + P+ S + SPS YLL+ R
Sbjct: 194 RSQVE--CRALDFSDCGTPGKAKVPSAS---PGGYSSPSSYLLKSCR 235


>tr|Q7XJ57|Q7XJ57_ARATH At4g32740 OS=Arabidopsis thaliana PE=2 SV=1
Length = 216

Score = 40.4 bits (93), Expect = 0.044
Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 1/107 (0%)
Frame = +3

Query: 27 RAEDALRVMQCLSRQAASAYMEAEEILSSLSTEQRLSQSMAAVLDEGKENILSAGDHGND 206
R+ DA+ +M+ LS +A+AY +A E+L + + E L + +GKEN D +
Sbjct: 115 RSYDAIGLMKHLSEHSATAYADALEVLGNDTPESILKKRQLNKSIQGKENQHQPHDQLGN 174

Query: 207 WFSVSPGCTLVDMSSWNIPSQ-MTPARSVHQRQSFESPSMYLLREYR 344
V C +D S P + P+ S + SPS YLL+ R
Sbjct: 175 RSQVE--CRALDFSDCGTPGKAKIPSAS---PGGYSSPSSYLLKSCR 216


>tr|A7P5B2|A7P5B2_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032464001
PE=4 SV=1
Length = 229

Score = 34.3 bits (77), Expect = 3.1
Identities = 28/106 (26%), Positives = 43/106 (40%)
Frame = +3

Query: 27 RAEDALRVMQCLSRQAASAYMEAEEILSSLSTEQRLSQSMAAVLDEGKENILSAGDHGND 206
R+ DA+ +M+ LS A + +A+E+L R+ S + N DH +
Sbjct: 131 RSYDAIGLMKQLSEHTAETFADAKEVL-------RIGASEVMSKERCSSNNNHDPDHQLE 183

Query: 207 WFSVSPGCTLVDMSSWNIPSQMTPARSVHQRQSFESPSMYLLREYR 344
S ++D S P + T F SPS YLL+ R
Sbjct: 184 NHSHLASERVLDFSDCGTPGKETTKGKSSAAPGFSSPSSYLLKGCR 229


>tr|Q948S5|Q948S5_TOBAC Myb OS=Nicotiana tabacum GN=NtmybA2 PE=2 SV=1
Length = 1042

Score = 33.9 bits (76), Expect = 4.1
Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 3/109 (2%)
Frame = +3

Query: 27 RAEDALRVMQCLSRQAASAYMEAEEILSSLSTEQ--RLSQSMAAVLDEGKENILSAGDHG 200
R+ DA+ +M+ LS Q A A+ +A+E+L + E R S DE ++LSA
Sbjct: 943 RSYDAIGLMKQLSEQTAGAFADAQEVLGGETPESILRGRNSKNQKADE-NHSLLSA---- 997

Query: 201 NDWFSVSPGCTLVDMSSWNIPSQMTPARS-VHQRQSFESPSMYLLREYR 344
+V +D S P + + SF SPS YLL+ R
Sbjct: 998 ----NVMSERRTLDFSECGSPGKGKETENFCTSNNSFSSPSSYLLKGCR 1042


>tr|A0YZW7|A0YZW7_9CYAN L-sorbosone dehydrogenase OS=Lyngbya sp. PCC
8106 GN=L8106_03849 PE=4 SV=1
Length = 617

Score = 33.5 bits (75), Expect = 5.3
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +3

Query: 96 EEILSSLSTEQRLSQSMAAVLDEGKENILSAGDHGNDWFS 215
+++ +L +Q L S L GK+N + GD GNDW S
Sbjct: 85 DQLFGNLGDDQLLGNSGNDTLWGGKQNDILTGDEGNDWLS 124


>tr|Q948S6|Q948S6_TOBAC Myb OS=Nicotiana tabacum GN=NtmybA1 PE=2 SV=1
Length = 1003

Score = 33.5 bits (75), Expect = 5.3
Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 1/107 (0%)
Frame = +3

Query: 27 RAEDALRVMQCLSRQAASAYMEAEEILSSLSTEQRLSQSMAAVLDEGKENILSAGDHGND 206
R+ DA+ +M+ LS Q A + +A +IL S + E LS+ + + L A +
Sbjct: 904 RSYDAIGLMKQLSEQTAPSIADAHQILGSETPETNLSKRNSKKPKADENCTLLASN---- 959

Query: 207 WFSVSPGCTLVDMSSWNIPSQ-MTPARSVHQRQSFESPSMYLLREYR 344
+ S TL D + IP + + SF SPS YLL+ R
Sbjct: 960 --ATSERRTL-DFNECGIPGKGKETTKFGSNNNSFSSPSSYLLKYCR 1003


>tr|B5WGT3|B5WGT3_9BURK NAD-dependent epimerase/dehydratase
OS=Burkholderia sp. H160 GN=BH160DRAFT_2284 PE=4 SV=1
Length = 216

Score = 33.1 bits (74), Expect = 7.0
Identities = 17/54 (31%), Positives = 30/54 (55%)
Frame = +3

Query: 132 LSQSMAAVLDEGKENILSAGDHGNDWFSVSPGCTLVDMSSWNIPSQMTPARSVH 293
+ +++AAV G ++ AG G+ WF SPG T+++ W P ++ P + H
Sbjct: 91 IERAIAAVRKAGVARLVMAGGCGSLWF--SPGVTVLESGRW--PEKLVPIATSH 140


>tr|Q8X1C0|Q8X1C0_USTMA Dkh6 (Putative uncharacterized protein)
OS=Ustilago maydis GN=dkh6 PE=4 SV=1
Length = 532

Score = 32.7 bits (73), Expect = 9.1
Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 5/93 (5%)
Frame = +3

Query: 57 CLSRQAASAYMEAEEILS---SLSTEQRLSQSMAAVLDEGKENILSAGDHGNDWFSVSPG 227
C SR+ A+AY++ ++ LS+ SMAA L G N + DH + S
Sbjct: 258 CASRRVAAAYLDVHRLVCINLILSSIGAFCISMAAGL-YGVPNSVYLVDHACSLDATSAA 316

Query: 228 CTL--VDMSSWNIPSQMTPARSVHQRQSFESPS 320
CT+ V + W I + RS H Q+ SPS
Sbjct: 317 CTMNHVQKTMWLI----SRGRSTHSDQAAGSPS 345