BP913069
Clone id YMU001_000026_B06
Library
Length 638
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000026_B06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTGAAAACAATAAGGGAATAAATTTCACTGAGTTTCTTCCATATGGAGGC
TGGAGATGTCAAAAACTTCCCTCTATAACCATATAACTAAATACAATATTGCACAAGTCA
AGACATTACACACTTGACCCGATCAAAAATAATCGAAGTTAAAAGAATCAGGAGTTCCAT
TTTGACGCCGGTTGCTGCTCATCTTCTTGCTTGACCATGCTTTTTTTCTGCTTTTGATTA
AATTTTGCAAAAGAATACCAAATGCCTCCAGCTGTATTGATAGCCAATCCAGTCACATTC
AAAGCATGGACCTTCACTCCCCCCAGCACAAGAAATCCTAGAGTCGTCGTGCCCACTCCT
TTCAAAACACCAACAATGGTTGTTGTCAAAGCAGAGTTGACTGCTGTACACAGGAACATT
GTGTAGTTCAACACTATTCCCATGATCAAAGAAACAAGGAAGAGCGTCAGGAAGCCAAAA
CTTTTGATCTTTTGTAGAAGCAGCACCCCAGAAAATGGCAGTTCCTTAGCAGCAAATATA
AGCAGCAGAATAAACGGGAGGGACAAAACGGAGTTGTATAGCATCAGCTCAATTGATGAA
AGGCCATCCTCAGCTGCGGATCTCTCCACCAAAACTAA
■■Homology search results ■■ -
sp_hit_id Q18779
Definition sp|Q18779|SQV7_CAEEL UDP-sugar transporter sqv-7 OS=Caenorhabditis elegans
Align length 124
Score (bit) 45.8
E-value 0.0002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913069|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_B06.
(626 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q18779|SQV7_CAEEL UDP-sugar transporter sqv-7 OS=Caenorhabdit... 46 2e-04
sp|Q5M8T2|S35D3_HUMAN Solute carrier family 35 member D3 OS=Homo... 46 2e-04
sp|Q8BGF8|S35D3_MOUSE Solute carrier family 35 member D3 OS=Mus ... 45 2e-04
sp|Q95YI5|US74C_DROME UDP-sugar transporter UST74c OS=Drosophila... 42 0.002
sp|A2VE55|S35D2_BOVIN UDP-N-acetylglucosamine/UDP-glucose/GDP-ma... 41 0.004
sp|Q76EJ3|S35D2_HUMAN UDP-N-acetylglucosamine/UDP-glucose/GDP-ma... 40 0.007
sp|Q5RDC9|S35D2_PONAB UDP-N-acetylglucosamine/UDP-glucose/GDP-ma... 40 0.013
sp|Q762D5|S35D2_MOUSE UDP-N-acetylglucosamine/UDP-glucose/GDP-ma... 40 0.013
sp|Q9NTN3|S35D1_HUMAN UDP-glucuronic acid/UDP-N-acetylgalactosam... 40 0.013
sp|Q15B89|S35D2_PIG UDP-N-acetylglucosamine/UDP-glucose/GDP-mann... 39 0.022
sp|P48914|NU4M_ALBCO NADH-ubiquinone oxidoreductase chain 4 OS=A... 33 1.2
sp|P40107|GMT1_YEAST GDP-mannose transporter 1 OS=Saccharomyces ... 33 1.2
sp|A6ZTW6|GMT1_YEAS7 GDP-mannose transporter 1 OS=Saccharomyces ... 33 1.2
sp|Q5UPE7|YL068_MIMIV Uncharacterized protein L68 OS=Acanthamoeb... 33 1.6
sp|Q4PFQ1|GMT_USTMA GDP-mannose transporter OS=Ustilago maydis G... 32 2.0
sp|Q4WTQ6|GMT_ASPFU GDP-mannose transporter OS=Aspergillus fumig... 32 2.0
sp|B0Y384|GMT_ASPFC GDP-mannose transporter OS=Aspergillus fumig... 32 2.0
sp|Q54PR9|CF60_DICDI Counting factor 60 OS=Dictyostelium discoid... 32 2.7
sp|A1CZJ3|GMT1_NEOFI GDP-mannose transporter 1 OS=Neosartorya fi... 32 3.5
sp|Q86W67|U638A_HUMAN UPF0638 protein A OS=Homo sapiens PE=2 SV=1 31 4.5
sp|Q54VS4|PSIO_DICDI Protein psiO OS=Dictyostelium discoideum GN... 31 4.5
sp|Q753T9|GMT_ASHGO GDP-mannose transporter OS=Ashbya gossypii G... 31 4.5
sp|Q6CYD0|GMT_KLULA GDP-mannose transporter OS=Kluyveromyces lac... 31 5.9
sp|A1C9R4|GMT_ASPCL GDP-mannose transporter OS=Aspergillus clava... 31 5.9
sp|A7TR80|GMT1_VANPO GDP-mannose transporter 1 OS=Vanderwaltozym... 31 5.9
sp|P36418|VILI_DICDI Protovillin OS=Dictyostelium discoideum GN=... 30 7.7
sp|Q9D361|SNR48_MOUSE U11/U12 small nuclear ribonucleoprotein 48... 30 7.7
sp|Q0S6R3|SERC_RHOSR Phosphoserine aminotransferase OS=Rhodococc... 30 7.7
sp|Q8IWA5|CTL2_HUMAN Choline transporter-like protein 2 OS=Homo ... 30 7.7
sp|Q810F1|CTL2_CAVPO Choline transporter-like protein 2 OS=Cavia... 30 7.7

>sp|Q18779|SQV7_CAEEL UDP-sugar transporter sqv-7 OS=Caenorhabditis
elegans GN=sqv-7 PE=1 SV=1
Length = 329

Score = 45.8 bits (107), Expect = 2e-04
Identities = 33/124 (26%), Positives = 48/124 (38%)
Frame = -1

Query: 590 LSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLFLVSLIMGIVLNY 411
L LM YN + L L ++ +L + +L + T FL+S I G VLNY
Sbjct: 184 LGKYGLMFYNCLFMLLPALCVVQYTGDLDRAYSFMLSDSMTSSVWTCFLLSCICGFVLNY 243

Query: 410 TMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAINTAGGIWYSFAK 231
++ LCT NSA N TG+ ++ G I Y++
Sbjct: 244 SLVLCTHHNSALTTTCVGPIKNLFVTYVGMFSSGDYVFQWANFTGINVSVFGSILYTYVT 303

Query: 230 FNQK 219
F K
Sbjct: 304 FRSK 307


>sp|Q5M8T2|S35D3_HUMAN Solute carrier family 35 member D3 OS=Homo
sapiens GN=SLC35D3 PE=2 SV=1
Length = 416

Score = 45.8 bits (107), Expect = 2e-04
Identities = 31/148 (20%), Positives = 64/148 (43%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
LVL+++++A+ + +V + P +++ FA+ + + K + +F
Sbjct: 172 LVLIQKASADTEHGPLTAQYVIAVSATPLLVICSFASTDSIHAWTF--PGWKDPAMVCIF 229

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
+ +++G +N+T CT +NSA +L + G+ +
Sbjct: 230 VACILIGCAMNFTTLHCTYINSAVTTSFVGVVKSIATITVGMVAFSDVEPTSLFIAGVVV 289

Query: 266 NTAGGIWYSFAKFNQKQKKSMVKQEDEQ 183
NT G I Y AKF + +K+S + + Q
Sbjct: 290 NTLGSIIYCVAKFMETRKQSNYEDLEAQ 317


>sp|Q8BGF8|S35D3_MOUSE Solute carrier family 35 member D3 OS=Mus
musculus GN=Slc35d3 PE=2 SV=1
Length = 422

Score = 45.4 bits (106), Expect = 2e-04
Identities = 30/148 (20%), Positives = 65/148 (43%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
LVL+++++A+ + +V + P +++ FA+ + + K +++F
Sbjct: 172 LVLIQKASADTEHGPLTAQYVIAVSATPLLVICSFASTDSIHAWTF--PGWKDPAMVSIF 229

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
+ +++G +N+T CT +NSA +L + G+ +
Sbjct: 230 VACILIGCAMNFTTLHCTYINSAVTTSFVGVVKSIATITVGMVAFSDVEPTSLFIAGVVV 289

Query: 266 NTAGGIWYSFAKFNQKQKKSMVKQEDEQ 183
NT G I Y AKF + +++S + + Q
Sbjct: 290 NTLGSIIYCVAKFLETRRQSNYEDLESQ 317


>sp|Q95YI5|US74C_DROME UDP-sugar transporter UST74c OS=Drosophila
melanogaster GN=frc PE=1 SV=2
Length = 373

Score = 42.4 bits (98), Expect = 0.002
Identities = 32/136 (23%), Positives = 52/136 (38%)
Frame = -1

Query: 623 VLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLFL 444
V V++ + LM YNS+ L L + L L ++ F+ FL
Sbjct: 224 VYVKKKLDTSEIGKYGLMYYNSLFMFLPALALNYVTGNL--DQALNFEQWNDSVFVVQFL 281

Query: 443 VSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAIN 264
+S +MG +L+Y+ LCT NSA LN G+ I+
Sbjct: 282 LSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINIS 341

Query: 263 TAGGIWYSFAKFNQKQ 216
+ Y++ F +K+
Sbjct: 342 VLASLLYTYVTFRRKR 357


>sp|A2VE55|S35D2_BOVIN
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose
transporter OS=Bos taurus GN=SLC35D2 PE=2 SV=1
Length = 355

Score = 41.2 bits (95), Expect = 0.004
Identities = 36/129 (27%), Positives = 51/129 (39%), Gaps = 4/129 (3%)
Frame = -1

Query: 590 LSSIELMLYNSV-LSLPFILLLIF---AAKELPFSGVLLLQKIKSFGFLTLFLVSLIMGI 423
L L+ YN++ + LP + + F A K L F G FL F +S +MG
Sbjct: 214 LGKYGLLYYNALFMILPTLAIAYFTGDAQKALDFEGWA------DTLFLLQFTLSCVMGF 267

Query: 422 VLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAINTAGGIWY 243
+L Y LCT NSA N GL I+ AG + Y
Sbjct: 268 ILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVY 327

Query: 242 SFAKFNQKQ 216
S+ F+++Q
Sbjct: 328 SYITFSEEQ 336


>sp|Q76EJ3|S35D2_HUMAN
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose
transporter OS=Homo sapiens GN=SLC35D2 PE=1 SV=1
Length = 337

Score = 40.4 bits (93), Expect = 0.007
Identities = 27/95 (28%), Positives = 39/95 (41%)
Frame = -1

Query: 473 KSFGFLTLFLVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVH 294
K+ F+ FL+S +G +L Y+ LC+ NSA
Sbjct: 236 KNVVFILQFLLSCFLGFLLMYSTVLCSYYNSALTTAVVGAIKNVSVAYIGILIGGDYIFS 295

Query: 293 ALNVTGLAINTAGGIWYSFAKFNQKQKKSMVKQED 189
LN GL I AGG+ YSF + + K V +E+
Sbjct: 296 LLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEEN 330


>sp|Q5RDC9|S35D2_PONAB
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose
transporter OS=Pongo abelii GN=SLC35D2 PE=2 SV=1
Length = 355

Score = 39.7 bits (91), Expect = 0.013
Identities = 35/129 (27%), Positives = 50/129 (38%), Gaps = 4/129 (3%)
Frame = -1

Query: 590 LSSIELMLYNSV-LSLPFILLLIF---AAKELPFSGVLLLQKIKSFGFLTLFLVSLIMGI 423
L L+ YN++ + LP + + F A K + F G FL F +S +MG
Sbjct: 214 LGKYGLLYYNALFMILPTLAIAYFTGDAQKAVEFEGWA------DTLFLLQFTLSCVMGF 267

Query: 422 VLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAINTAGGIWY 243
+L Y LCT NSA N GL I+ AG + Y
Sbjct: 268 ILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVY 327

Query: 242 SFAKFNQKQ 216
S+ F ++Q
Sbjct: 328 SYITFTEEQ 336


>sp|Q762D5|S35D2_MOUSE
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose
transporter OS=Mus musculus GN=Slc35d2 PE=2 SV=1
Length = 326

Score = 39.7 bits (91), Expect = 0.013
Identities = 33/134 (24%), Positives = 51/134 (38%)
Frame = -1

Query: 590 LSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLFLVSLIMGIVLNY 411
L ++ YN+ L I +I + F + K+ F+ FL+S ++G +L Y
Sbjct: 187 LGKYGVLFYNACFML--IPTVIISVSTGDFQQATEFRHWKNVLFIIQFLLSCLLGFLLMY 244

Query: 410 TMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAINTAGGIWYSFAK 231
+ LC+ NSA LN GL I AGG+ YSF
Sbjct: 245 STALCSYYNSALTTAVVGAIKNVSVAYIGMLVGGDYIFSLLNFIGLNICMAGGLRYSFLT 304

Query: 230 FNQKQKKSMVKQED 189
+ + K E+
Sbjct: 305 LSSQLKPKQPVDEE 318


>sp|Q9NTN3|S35D1_HUMAN UDP-glucuronic acid/UDP-N-acetylgalactosamine
transporter OS=Homo sapiens GN=SLC35D1 PE=1 SV=1
Length = 355

Score = 39.7 bits (91), Expect = 0.013
Identities = 35/129 (27%), Positives = 50/129 (38%), Gaps = 4/129 (3%)
Frame = -1

Query: 590 LSSIELMLYNSV-LSLPFILLLIF---AAKELPFSGVLLLQKIKSFGFLTLFLVSLIMGI 423
L L+ YN++ + LP + + F A K + F G FL F +S +MG
Sbjct: 214 LGKYGLLYYNALFMILPTLAIAYFTGDAQKAVEFEGWA------DTLFLLQFTLSCVMGF 267

Query: 422 VLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAINTAGGIWY 243
+L Y LCT NSA N GL I+ AG + Y
Sbjct: 268 ILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVY 327

Query: 242 SFAKFNQKQ 216
S+ F ++Q
Sbjct: 328 SYITFTEEQ 336


>sp|Q15B89|S35D2_PIG UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose
transporter (Fragment) OS=Sus scrofa GN=SLC35D2 PE=2
SV=1
Length = 343

Score = 38.9 bits (89), Expect = 0.022
Identities = 24/82 (29%), Positives = 33/82 (40%)
Frame = -1

Query: 461 FLTLFLVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNV 282
FL F +S +MG +L Y LCT NSA N
Sbjct: 243 FLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNF 302

Query: 281 TGLAINTAGGIWYSFAKFNQKQ 216
GL I+ AG + YS+ F+++Q
Sbjct: 303 IGLNISIAGSLVYSYITFSEEQ 324


tr_hit_id A7QJQ6
Definition tr|A7QJQ6|A7QJQ6_VITVI Chromosome undetermined scaffold_107, whole genome shotgun sequence OS=Vitis vinifera
Align length 139
Score (bit) 142.0
E-value 2.0e-32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913069|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_B06.
(626 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QJQ6|A7QJQ6_VITVI Chromosome undetermined scaffold_107, who... 142 2e-32
tr|A5BXX8|A5BXX8_VITVI Putative uncharacterized protein OS=Vitis... 142 2e-32
tr|B6U002|B6U002_MAIZE UDP-glucuronic acid/UDP-N-acetylgalactosa... 138 2e-31
tr|Q9SB76|Q9SB76_ARATH Putative uncharacterized protein F28M20.2... 138 3e-31
tr|Q94B65|Q94B65_ARATH Putative uncharacterized protein F28M20.2... 138 3e-31
tr|Q69KL6|Q69KL6_ORYSJ Os06g0188100 protein OS=Oryza sativa subs... 137 4e-31
tr|A2YA49|A2YA49_ORYSI Putative uncharacterized protein OS=Oryza... 137 4e-31
tr|B4FN98|B4FN98_MAIZE Putative uncharacterized protein OS=Zea m... 99 3e-19
tr|A9S965|A9S965_PHYPA Predicted protein (Fragment) OS=Physcomit... 91 6e-17
tr|A9RVY0|A9RVY0_PHYPA Predicted protein (Fragment) OS=Physcomit... 88 5e-16
tr|A9U257|A9U257_PHYPA Predicted protein OS=Physcomitrella paten... 81 4e-14
tr|A7RWP3|A7RWP3_NEMVE Predicted protein OS=Nematostella vectens... 75 3e-12
tr|Q2V3D2|Q2V3D2_ARATH Uncharacterized protein At4g31600.2 OS=Ar... 67 7e-10
tr|A4RY61|A4RY61_OSTLU DMT family transporter: UDP-glucuronic ac... 64 6e-09
tr|B3RRI3|B3RRI3_TRIAD Putative uncharacterized protein (Fragmen... 60 1e-07
tr|Q551D6|Q551D6_DICDI Putative uncharacterized protein OS=Dicty... 58 4e-07
tr|A8JF68|A8JF68_CHLRE Predicted protein (Fragment) OS=Chlamydom... 55 3e-06
tr|A7RTQ9|A7RTQ9_NEMVE Predicted protein OS=Nematostella vectens... 54 6e-06
tr|Q011D3|Q011D3_OSTTA UDP-glucuronic acid/UDP-N-acetylgalactosa... 53 2e-05
tr|A7PF85|A7PF85_VITVI Chromosome chr11 scaffold_13, whole genom... 50 1e-04
tr|B4FQJ7|B4FQJ7_MAIZE Putative uncharacterized protein OS=Zea m... 49 2e-04
tr|B4FP44|B4FP44_MAIZE Putative uncharacterized protein OS=Zea m... 49 2e-04
tr|B4FA00|B4FA00_MAIZE Putative uncharacterized protein OS=Zea m... 49 2e-04
tr|A8IQ31|A8IQ31_CHLRE Predicted protein (Fragment) OS=Chlamydom... 49 2e-04
tr|A9V127|A9V127_MONBE Predicted protein OS=Monosiga brevicollis... 49 2e-04
tr|B4LE88|B4LE88_DROVI GJ13023 OS=Drosophila virilis GN=GJ13023 ... 49 2e-04
tr|Q7SXZ5|Q7SXZ5_DANRE Zgc:63651 OS=Danio rerio GN=slc35d1b PE=2... 48 4e-04
tr|B4N6G1|B4N6G1_DROWI GK18051 OS=Drosophila willistoni GN=GK180... 48 4e-04
tr|B4J253|B4J253_DROGR GH14906 OS=Drosophila grimshawi GN=GH1490... 47 7e-04
tr|A9SV58|A9SV58_PHYPA Predicted protein OS=Physcomitrella paten... 47 0.001

>tr|A7QJQ6|A7QJQ6_VITVI Chromosome undetermined scaffold_107, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00000742001 PE=4 SV=1
Length = 324

Score = 142 bits (357), Expect = 2e-32
Identities = 76/139 (54%), Positives = 89/139 (64%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
LVLVE+S AEDG SS+E+M YNS LSLPF+L LI A E P S LL+ K S FL +
Sbjct: 173 LVLVEKSGAEDGHSSVEIMFYNSFLSLPFLLFLIIATGEFPNSLSLLVAKSNSLSFLVIL 232

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
++SL+MGI LNYTMFLCT VNSA VHALNVTGL I
Sbjct: 233 ILSLVMGIALNYTMFLCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVKVHALNVTGLVI 292

Query: 266 NTAGGIWYSFAKFNQKQKK 210
NTAGG+WYS+AK+ QK+ K
Sbjct: 293 NTAGGVWYSYAKYQQKKSK 311


>tr|A5BXX8|A5BXX8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041431 PE=4 SV=1
Length = 296

Score = 142 bits (357), Expect = 2e-32
Identities = 76/139 (54%), Positives = 89/139 (64%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
LVLVE+S AEDG SS+E+M YNS LSLPF+L LI A E P S LL+ K S FL +
Sbjct: 145 LVLVEKSGAEDGHSSVEIMFYNSFLSLPFLLFLIIATGEFPNSLSLLVAKSNSLSFLVIL 204

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
++SL+MGI LNYTMFLCT VNSA VHALNVTGL I
Sbjct: 205 ILSLVMGIALNYTMFLCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVKVHALNVTGLVI 264

Query: 266 NTAGGIWYSFAKFNQKQKK 210
NTAGG+WYS+AK+ QK+ K
Sbjct: 265 NTAGGVWYSYAKYQQKKSK 283


>tr|B6U002|B6U002_MAIZE UDP-glucuronic
acid/UDP-N-acetylgalactosamine transporter OS=Zea mays
PE=2 SV=1
Length = 323

Score = 138 bits (348), Expect = 2e-31
Identities = 75/153 (49%), Positives = 92/153 (60%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
L+LVE+S AEDGLSS++LM YNS+LSLPF+ LI A E P S +L K S F +
Sbjct: 171 LILVEKSGAEDGLSSVDLMFYNSILSLPFLFFLIIATGEFPHSLTVLSAKAASLTFGVIL 230

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
++SL+MGIVLN+TMF CT VNSA VHALNVTGL I
Sbjct: 231 VISLVMGIVLNFTMFWCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHALNVTGLVI 290

Query: 266 NTAGGIWYSFAKFNQKQKKSMVKQEDEQQPASK 168
NT GG+WYS+AK+ QK+K Q D + A K
Sbjct: 291 NTFGGVWYSYAKYKQKRKTPRKIQHDVESHAHK 323


>tr|Q9SB76|Q9SB76_ARATH Putative uncharacterized protein F28M20.210
(Putative uncharacterized protein AT4g31600)
OS=Arabidopsis thaliana GN=F28M20.210 PE=2 SV=1
Length = 296

Score = 138 bits (347), Expect = 3e-31
Identities = 74/139 (53%), Positives = 89/139 (64%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
LVLVE+S AEDGLSSIE+M YNS LSLPF+ +LI E P S LLL K FL +
Sbjct: 145 LVLVEKSGAEDGLSSIEIMFYNSFLSLPFLSILIIVTGEFPNSLSLLLAKCSYLPFLVIL 204

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
++SL+MGIVLN+TMFLCT VNSA VHALNV+GL +
Sbjct: 205 ILSLVMGIVLNFTMFLCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHALNVSGLVV 264

Query: 266 NTAGGIWYSFAKFNQKQKK 210
NTAGG+WYS+AK+ QK+ K
Sbjct: 265 NTAGGVWYSYAKYRQKKAK 283


>tr|Q94B65|Q94B65_ARATH Putative uncharacterized protein F28M20.210
(Putative uncharacterized protein At4g31600; F28M20.210)
OS=Arabidopsis thaliana GN=F28M20.210 PE=2 SV=1
Length = 323

Score = 138 bits (347), Expect = 3e-31
Identities = 74/139 (53%), Positives = 89/139 (64%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
LVLVE+S AEDGLSSIE+M YNS LSLPF+ +LI E P S LLL K FL +
Sbjct: 172 LVLVEKSGAEDGLSSIEIMFYNSFLSLPFLSILIIVTGEFPNSLSLLLAKCSYLPFLVIL 231

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
++SL+MGIVLN+TMFLCT VNSA VHALNV+GL +
Sbjct: 232 ILSLVMGIVLNFTMFLCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHALNVSGLVV 291

Query: 266 NTAGGIWYSFAKFNQKQKK 210
NTAGG+WYS+AK+ QK+ K
Sbjct: 292 NTAGGVWYSYAKYRQKKAK 310


>tr|Q69KL6|Q69KL6_ORYSJ Os06g0188100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0005A05.18 PE=2 SV=1
Length = 323

Score = 137 bits (346), Expect = 4e-31
Identities = 73/138 (52%), Positives = 88/138 (63%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
L+LVE+S AEDGLSS+ELM YNSVLSLPF+ +I A E P+S +L +K S F +
Sbjct: 171 LILVEKSGAEDGLSSVELMFYNSVLSLPFLFFIIIATGEFPYSLSVLSEKTASLTFSAIL 230

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
LVSL+MGIVLN+TMF CT VNSA VH LNVTGL I
Sbjct: 231 LVSLVMGIVLNFTMFWCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHTLNVTGLVI 290

Query: 266 NTAGGIWYSFAKFNQKQK 213
NT GG+WYS+AK+ QK+K
Sbjct: 291 NTFGGVWYSYAKYMQKRK 308


>tr|A2YA49|A2YA49_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21963 PE=4 SV=1
Length = 323

Score = 137 bits (346), Expect = 4e-31
Identities = 73/138 (52%), Positives = 88/138 (63%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
L+LVE+S AEDGLSS+ELM YNSVLSLPF+ +I A E P+S +L +K S F +
Sbjct: 171 LILVEKSGAEDGLSSVELMFYNSVLSLPFLFFIIIATGEFPYSLSVLSEKTASLTFSAIL 230

Query: 446 LVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLAI 267
LVSL+MGIVLN+TMF CT VNSA VH LNVTGL I
Sbjct: 231 LVSLVMGIVLNFTMFWCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHTLNVTGLVI 290

Query: 266 NTAGGIWYSFAKFNQKQK 213
NT GG+WYS+AK+ QK+K
Sbjct: 291 NTFGGVWYSYAKYMQKRK 308


>tr|B4FN98|B4FN98_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 285

Score = 98.6 bits (244), Expect = 3e-19
Identities = 49/83 (59%), Positives = 61/83 (73%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFSGVLLLQKIKSFGFLTLF 447
L+LVE+S AEDGLSS++LM YNS+LSLPF+ LI A E P S +L K S F +
Sbjct: 171 LILVEKSGAEDGLSSVDLMFYNSILSLPFLFFLIIATGEFPHSLTVLSAKAASLTFGVIL 230

Query: 446 LVSLIMGIVLNYTMFLCTAVNSA 378
++SL+MGIVLN+TMF CT VNSA
Sbjct: 231 VISLVMGIVLNFTMFWCTIVNSA 253


>tr|A9S965|A9S965_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_16485 PE=4 SV=1
Length = 296

Score = 90.9 bits (224), Expect = 6e-17
Identities = 52/137 (37%), Positives = 72/137 (52%), Gaps = 1/137 (0%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKELPFS-GVLLLQKIKSFGFLTL 450
L+LVER+ E G +S+EL+LYN +LSLP +L++I E+ S + +Q +S FL L
Sbjct: 160 LLLVERTGTEKGFNSMELLLYNGILSLPVLLIIILGTGEVWDSFESMRIQSRESLAFLPL 219

Query: 449 FLVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGLA 270
LVSL+MG +LNY +FLCT NSA G+
Sbjct: 220 LLVSLLMGSLLNYCLFLCTLCNSALTTTIVGTLRSVLGTVLGFFVFGGVKGTIFIFLGVL 279

Query: 269 INTAGGIWYSFAKFNQK 219
NT GG+WY+ KF +K
Sbjct: 280 FNTLGGVWYTLIKFKEK 296


>tr|A9RVY0|A9RVY0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_119936 PE=4 SV=1
Length = 315

Score = 87.8 bits (216), Expect = 5e-16
Identities = 52/142 (36%), Positives = 73/142 (51%), Gaps = 2/142 (1%)
Frame = -1

Query: 626 LVLVERSAAEDGLSSIELMLYNSVLSLPFILLLIFAAKEL--PFSGVLLLQKIKSFGFLT 453
L+LVERS E G SS+EL+LYN +LSLP +L +I E+ G + Q ++ FL
Sbjct: 161 LILVERSGNEKGFSSMELLLYNGILSLPVLLTIILTTGEIWKAMEG-MQAQCAQNVWFLP 219

Query: 452 LFLVSLIMGIVLNYTMFLCTAVNSAXXXXXXXXXXXXXXXXXXXXXXXXXXVHALNVTGL 273
L + SL+MG +LNY +FLCT NSA + G+
Sbjct: 220 LLISSLLMGSLLNYCLFLCTLCNSALTTTIVGTLRSVLATVAGFFVFGGVKGTPSILLGV 279

Query: 272 AINTAGGIWYSFAKFNQKQKKS 207
NT GG+WY+ K+ +KQ K+
Sbjct: 280 TTNTVGGVWYTMIKYKEKQVKT 301