BP913109
Clone id YMU001_000026_E12
Library
Length 266
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000026_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATCTGACAAAGAGGTGACACACTTGTCGCAACACATTGATGGAAGTTGATGGAAAAGTCG
GTCACATAGTGTCATTAGTTGGTAGCATCATGCTCATGAAGGAACCATCAACTTGACATC
AAATTTCTCCATTTTGGCATTTGAACTTAAGCATTGTGTTGAAAGAATTTAAAATTCGCA
AATCCAACTATGTGTATGTTAGCACACATGCCTACAAGGGCATCACAACGGAGTGGAGAA
GGTCTCATCTTCAAGATCATTGGTTT
■■Homology search results ■■ -
sp_hit_id Q54FZ4
Definition sp|Q54FZ4|Y8927_DICDI Putative uncharacterized protein DDB_G0290521 OS=Dictyostelium discoideum
Align length 75
Score (bit) 29.6
E-value 5.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913109|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_E12.
(266 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54FZ4|Y8927_DICDI Putative uncharacterized protein DDB_G0290... 30 5.0
sp|Q99PG6|TS1R1_MOUSE Taste receptor type 1 member 1 OS=Mus musc... 29 8.5

>sp|Q54FZ4|Y8927_DICDI Putative uncharacterized protein DDB_G0290521
OS=Dictyostelium discoideum GN=DDB_G0290521 PE=4 SV=1
Length = 468

Score = 29.6 bits (65), Expect = 5.0
Identities = 17/75 (22%), Positives = 34/75 (45%)
Frame = +3

Query: 18 HTCRNTLMEVDGKVGHIVSLVGSIMLMKEPST*HQISPFWHLNLSIVLKEFKIRKSNYVY 197
H+ N L+E + + +L+ + H + LN I LK KI++S ++Y
Sbjct: 394 HSSSNELLEKNSDGNSSCKNIPKYLLIMQTPIFHFQLKSFRLNEKITLKRIKIKQSPFIY 453

Query: 198 VSTHAYKGITTEWRR 242
+ ++ I W++
Sbjct: 454 LWIKSHILIYQNWKK 468


>sp|Q99PG6|TS1R1_MOUSE Taste receptor type 1 member 1 OS=Mus
musculus GN=Tas1r1 PE=2 SV=1
Length = 842

Score = 28.9 bits (63), Expect = 8.5
Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%)
Frame = +2

Query: 65 HSVISW*HHAHEGTINLTSNFSILAFELKHCVERI*----NSQIQLCVC*HTCLQGHH 226
+ +I+W + E T + + S+ L +I N+Q+ + VC CL+GHH
Sbjct: 450 YDIIAWDWNGPEWTFEVIGSASLSPVHLDINKTKIQWHGKNNQVPVSVCTRDCLEGHH 507


tr_hit_id Q41584
Definition tr|Q41584|Q41584_WHEAT Thaumatin-like protein OS=Triticum aestivum
Align length 40
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913109|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_E12.
(266 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q41584|Q41584_WHEAT Thaumatin-like protein OS=Triticum aestiv... 34 4.1
tr|Q3S4I2|Q3S4I2_TRIMO Pathogenesis-related 5 OS=Triticum monoco... 34 4.1

>tr|Q41584|Q41584_WHEAT Thaumatin-like protein OS=Triticum aestivum
PE=2 SV=1
Length = 176

Score = 33.9 bits (76), Expect = 4.1
Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
Frame = -2

Query: 184 DLRILNSFNTMLKFKCQNG-EI*CQVDGSFMSMMLPTNDT 68
D+ +++ FN L F C NG + CQ D + + PT+DT
Sbjct: 119 DISVIDGFNVPLSFSCSNGPNLVCQADKCPDAYLFPTDDT 158


>tr|Q3S4I2|Q3S4I2_TRIMO Pathogenesis-related 5 OS=Triticum
monococcum PE=2 SV=1
Length = 176

Score = 33.9 bits (76), Expect = 4.1
Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
Frame = -2

Query: 184 DLRILNSFNTMLKFKCQNG-EI*CQVDGSFMSMMLPTNDT 68
D+ +++ FN L F C NG + CQ D + + PT+DT
Sbjct: 119 DISVIDGFNVPLSFSCSNGPNLVCQADKCPDAYLFPTDDT 158