BP913120
Clone id YMU001_000026_F11
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000026_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTGCCAACAGTATCTCTCTATGTCTATGTATCTCCACTAGAAAACGACCAAACTGGCGT
TGATCTCAGGACTCCATGATCTATCATAGGGTCTTGTAAAAAGAGTCTCATCTATCTTTG
ATACTTTGACATGCTCTACATCTGCAAAACAGATGCTCCTCGTCCTCAATCACCCTCTCT
GTGCAAAGCTAGCAGAACCTCTCATCAGGGGGGTATGAGGAGCTCTTCTTGTCTCTATCT
CTAGCCGGAGTGATGATACTCAGAGCTGACCAATCGCCACTCGTGAGCTATGTGGAATGT
ATGTATCCAAGTAGTGCAGTCTCTAAATAAATCCCTTGTTTAGCATGGTCAAGAAGTGCT
CAATGTAATACACCATCTTCAAAGGAAGAGGCACGTCTCTCTAATACAGATCTACCATAG
ATCCTCTCTGAGTAGTGTGTTATCTCACTATGTGAGAACTCAATGAAGGGTGAGTTCTCA
GGACGGGTCATACTGGAAGGGTGGTAATCTATCCATGTCTAGTCCATGTG
■■Homology search results ■■ -
sp_hit_id Q75B70
Definition sp|Q75B70|STU1_ASHGO Protein STU1 OS=Ashbya gossypii
Align length 128
Score (bit) 30.8
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913120|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_F11.
(530 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q75B70|STU1_ASHGO Protein STU1 OS=Ashbya gossypii GN=STU1 PE=... 31 4.2
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated gluco... 30 5.5
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette tran... 30 9.4

>sp|Q75B70|STU1_ASHGO Protein STU1 OS=Ashbya gossypii GN=STU1 PE=3
SV=1
Length = 1476

Score = 30.8 bits (68), Expect = 4.2
Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 3/128 (2%)
Frame = +2

Query: 89 GSCKKSLIYL*YFDMLYICKTDAPRPQSPSLCKASRTSHQGGMRSSSCLYL*PE**YSEL 268
GS KSL + +Y+CK A + S+C A+R G R+ L++ ++
Sbjct: 111 GSAVKSL------EAIYLCKPQAFEAELASICAATR----GSDRTKCLLFMDELIQLQQM 160

Query: 269 TNRHS*AMWNVCIQV-VQSLNKSLV*HGQEVLNVIHHLQRK--RHVSLIQIYHRSSLSSV 439
NR+ + N + + V LN+S + + +IH + +K L Q R +
Sbjct: 161 NNRNPMEVVNRFVDLWVDVLNESDPGCSKRDIELIHDILKKYFNEAMLQQFAERVVNTRS 220

Query: 440 LSHYVRTQ 463
L H++ T+
Sbjct: 221 LKHFMHTE 228


>sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose
transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2
SV=1
Length = 553

Score = 30.4 bits (67), Expect = 5.5
Identities = 16/43 (37%), Positives = 27/43 (62%)
Frame = -2

Query: 457 SHIVR*HTTQRGSMVDLY*RDVPLPLKMVYYIEHFLTMLNKGF 329
S IVR H QRG++V LY + + + + Y + +FL+ +N G+
Sbjct: 124 SEIVRPH--QRGTLVSLYETGITVGILISYAMNYFLSAVNDGW 164


>sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette
transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3
Length = 2273

Score = 29.6 bits (65), Expect = 9.4
Identities = 18/50 (36%), Positives = 26/50 (52%)
Frame = +1

Query: 220 ELFLSLSLAGVMILRADQSPLVSYVECMYPSSAVSK*IPCLAWSRSAQCN 369
EL LSL V+I + +PL S+ EC +P+ A+ L W + CN
Sbjct: 28 ELVWPLSLFLVLIWLRNANPLYSHHECHFPNKAMPS-AGMLPWLQGIFCN 76


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913120|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_F11.
(530 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******