BP913129
Clone id YMU001_000026_G08
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000026_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGTGTGTGTATGTTGGTCCTGCTGCCGCTGGTTCTGGAATTCCAGAAGTGAAGGCTTAT
CTTAATGGCATCGATGTACCTGATATATTAGCTCCAAGAGCTCTATTTGTGAAGGTCTTT
GGGAGCATAGGCTCTGTAGCAGGAGGTCTTGATGCGGGTAAGCAAGGTCCGTTGGCGCAT
ACTGGGGCTTACATTGCTGCGTTGCTGAGTCAGGGTGGGTCAGAAGATCACCATTTATCT
TGGGGGTGGTTACGGTCTGTTAAGAACAATAAGGATAAGCGCGACCTTGTGACGTGTGGA
GCTGCCGCGGGGGTGGCAGCAGCATTCAGAGCACCTGTAGGTGGTGTGTTGTTTGCACTT
GAAGAAGTAACATCATGGTGGCGAAATCTTCTCTTATGGAGAGTTTTTATTTCTACTGCC
TTGGTAGCTGTCGTCTTGCGGACTGCCAGTAGCTTCTGCGGTGATACTAATTGTGGCCTG
TATGGCCATGAAGGCCTGATTATGTATAGCATTGGAAATTTCTCTGT
■■Homology search results ■■ -
sp_hit_id Q96282
Definition sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana
Align length 172
Score (bit) 197.0
E-value 3.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913129|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_G08.
(527 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidops... 197 3e-50
sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidops... 184 3e-46
sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidops... 182 7e-46
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidops... 177 3e-44
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-... 171 3e-42
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium... 107 3e-23
sp|P51799|CLCN7_RAT Chloride channel protein 7 OS=Rattus norvegi... 101 2e-21
sp|O70496|CLCN7_MOUSE Chloride channel protein 7 OS=Mus musculus... 101 2e-21
sp|P51798|CLCN7_HUMAN Chloride channel protein 7 OS=Homo sapiens... 101 2e-21
sp|Q4PKH3|CLCN7_BOVIN Chloride channel protein 7 OS=Bos taurus G... 101 2e-21
sp|Q9TT16|CLCN6_RABIT Chloride channel protein 6 OS=Oryctolagus ... 97 4e-20
sp|O35454|CLCN6_MOUSE Chloride channel protein 6 OS=Mus musculus... 96 8e-20
sp|P51797|CLCN6_HUMAN Chloride channel protein 6 OS=Homo sapiens... 94 3e-19
sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium... 90 8e-18
sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium... 80 5e-15
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium... 77 4e-14
sp|P51792|CLCN3_RAT Chloride channel protein 3 OS=Rattus norvegi... 65 2e-10
sp|O18894|CLCN3_RABIT Chloride channel protein 3 OS=Oryctolagus ... 65 2e-10
sp|P51791|CLCN3_MOUSE Chloride channel protein 3 OS=Mus musculus... 65 2e-10
sp|P51790|CLCN3_HUMAN Chloride channel protein 3 OS=Homo sapiens... 65 2e-10
sp|Q9R279|CLCN3_CAVPO Chloride channel protein 3 OS=Cavia porcel... 65 2e-10
sp|Q5RDJ7|CLCN3_PONAB Chloride channel protein 3 OS=Pongo abelii... 65 2e-10
sp|Q9TTU3|CLCN5_RABIT Chloride channel protein 5 OS=Oryctolagus ... 64 6e-10
sp|Q9GKE7|CLCN5_PIG Chloride channel protein 5 OS=Sus scrofa GN=... 63 8e-10
sp|P51796|CLCN5_RAT Chloride channel protein 5 OS=Rattus norvegi... 63 1e-09
sp|Q5RBK4|CLCN5_PONAB Chloride channel protein 5 OS=Pongo abelii... 63 1e-09
sp|Q9WVD4|CLCN5_MOUSE Chloride channel protein 5 OS=Mus musculus... 63 1e-09
sp|P51795|CLCN5_HUMAN Chloride channel protein 5 OS=Homo sapiens... 63 1e-09
sp|P51794|CLCN4_RAT Chloride channel protein 4 OS=Rattus norvegi... 62 1e-09
sp|P51793|CLCN4_HUMAN Chloride channel protein 4 OS=Homo sapiens... 62 1e-09

>sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis
thaliana GN=CLC-C PE=1 SV=1
Length = 779

Score = 197 bits (501), Expect = 3e-50
Identities = 96/172 (55%), Positives = 114/172 (66%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C ++ PAAAGSGIPEVKAYLNGID ILAP LFVK+FGSI VA G GK+GP+ HT
Sbjct: 159 CAFIAPAAAGSGIPEVKAYLNGIDAYSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHT 218

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS+ + L+W WLR KN++D+RDL LFALE
Sbjct: 219 GACIANLLGQGGSKKYRLTWKWLRFFKNDRDRRDLITCGAAAGVAAAFRAPVGGVLFALE 278

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E SWWRN LLWR F +TA+VAVVLR+ FC CGL+G GLIM+ + +
Sbjct: 279 EAASWWRNALLWRTFFTTAVVAVVLRSLIEFCRSGRCGLFGKGGLIMFDVNS 330


>sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis
thaliana GN=CLC-B PE=1 SV=1
Length = 780

Score = 184 bits (466), Expect = 3e-46
Identities = 85/172 (49%), Positives = 109/172 (63%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
CV P AAG GIPE+KAYLNG+D P++ + VK+ GSIG+VA GLD GK+GPL H
Sbjct: 149 CVCFAPTAAGPGIPEIKAYLNGVDTPNMFGATTMIVKIVGSIGAVAAGLDLGKEGPLVHI 208

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
G+ IA+LL QGG+++H + W WLR N++D+RDL LFALE
Sbjct: 209 GSCIASLLGQGGTDNHRIKWRWLRYFNNDRDRRDLITCGSAAGVCAAFRSPVGGVLFALE 268

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
EV +WWR+ LLWR F STA+V VVLR C CGL+G GLIM+ + +
Sbjct: 269 EVATWWRSALLWRTFFSTAVVVVVLREFIEICNSGKCGLFGKGGLIMFDVSH 320


>sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis
thaliana GN=CLC-A PE=1 SV=2
Length = 775

Score = 182 bits (463), Expect = 7e-46
Identities = 86/171 (50%), Positives = 108/171 (63%)
Frame = +1

Query: 7 VYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTG 186
VY P AAG GIPE+KAYLNGID P++ + VK+ GSIG+VA GLD GK+GPL H G
Sbjct: 151 VYFAPTAAGPGIPEIKAYLNGIDTPNMFGFTTMMVKIVGSIGAVAAGLDLGKEGPLVHIG 210

Query: 187 AYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEE 366
+ IA+LL QGG ++H + W WLR N++D+RDL LFALEE
Sbjct: 211 SCIASLLGQGGPDNHRIKWRWLRYFNNDRDRRDLITCGSASGVCAAFRSPVGGVLFALEE 270

Query: 367 VTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
V +WWR+ LLWR F STA+V VVLR C CGL+G GLIM+ + +
Sbjct: 271 VATWWRSALLWRTFFSTAVVVVVLRAFIEICNSGKCGLFGSGGLIMFDVSH 321


>sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis
thaliana GN=CLC-D PE=1 SV=2
Length = 792

Score = 177 bits (449), Expect = 3e-44
Identities = 88/167 (52%), Positives = 112/167 (67%)
Frame = +1

Query: 19 PAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTGAYIA 198
PAAAGSGIPE+K YLNGID+P L R L K+FGSIGSV GGL GK+GPL HTGA IA
Sbjct: 144 PAAAGSGIPEIKGYLNGIDIPGTLLFRTLIGKIFGSIGSVGGGLALGKEGPLVHTGACIA 203

Query: 199 ALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEEVTSW 378
+LL QGGS +HL+ W + K+++D+RDL LFALEEVTSW
Sbjct: 204 SLLGQGGSTKYHLNSRWPQLFKSDRDRRDLVTCGCAAGVAAAFRAPVGGVLFALEEVTSW 263

Query: 379 WRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
WR+ L+WRVF ++A+VAVV+RTA +C CG +G G I++ + +
Sbjct: 264 WRSQLMWRVFFTSAIVAVVVRTAMGWCKSGICGHFGGGGFIIWDVSD 310


>sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g
OS=Arabidopsis thaliana GN=At5g33280 PE=2 SV=1
Length = 763

Score = 171 bits (432), Expect = 3e-42
Identities = 83/168 (49%), Positives = 111/168 (66%)
Frame = +1

Query: 10 YVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTGA 189
+V PAAAGSGIPEVKAYLNG+D P+I + R L +K+ G+I +V+ L GK GP+ HTGA
Sbjct: 136 FVAPAAAGSGIPEVKAYLNGVDAPEIFSLRTLIIKIIGNISAVSASLLIGKAGPMVHTGA 195

Query: 190 YIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEEV 369
+A++L QGGS+ + L+W WLR KN++D+RDL LFALEE+
Sbjct: 196 CVASILGQGGSKRYRLTWRWLRFFKNDRDRRDLVTCGAAAGIAASFRAPVGGVLFALEEM 255

Query: 370 TSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSI 513
+SW + LLWR+F STA+VA+VLR C CGL+G GLIM+ +
Sbjct: 256 SSW--SALLWRIFFSTAVVAIVLRALIDVCLSGKCGLFGKGGLIMFDV 301


>sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium
discoideum GN=clcD PE=3 SV=1
Length = 1000

Score = 107 bits (268), Expect = 3e-23
Identities = 61/170 (35%), Positives = 83/170 (48%)
Frame = +1

Query: 7 VYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTG 186
VY P AAGSGIPEVK YLNG +P L + L+ K + +V+ GL AG +GP+ H G
Sbjct: 319 VYYEPTAAGSGIPEVKGYLNGTKIPHTLKMKTLWTKFLSMVLAVSSGLQAGSEGPMIHIG 378

Query: 187 AYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEE 366
A + SQ S++ +LRS +N+KDKRD LF+LEE
Sbjct: 379 AIVGNGFSQAQSKEFGFKIPFLRSFRNDKDKRDFVTSGAGAGVAAAFSAPLGGTLFSLEE 438

Query: 367 VTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIG 516
V+S+W L WR F + + S G GLI+++ G
Sbjct: 439 VSSFWSIALTWRAFFCCMVATYTMNVLQSNSGSLT-------GLIIFNTG 481


>sp|P51799|CLCN7_RAT Chloride channel protein 7 OS=Rattus norvegicus
GN=Clcn7 PE=2 SV=1
Length = 803

Score = 101 bits (252), Expect = 2e-21
Identities = 51/143 (35%), Positives = 77/143 (53%)
Frame = +1

Query: 10 YVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTGA 189
++ P AAGSGIP++K +LNG+ +P ++ + L +KV G I SV GGL GK+GP+ H+G+
Sbjct: 194 FIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGS 253

Query: 190 YIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEEV 369
IAA +SQG S + + + +KRD LF+LEE
Sbjct: 254 VIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEG 313

Query: 370 TSWWRNLLLWRVFISTALVAVVL 438
S+W L WR+F ++ + L
Sbjct: 314 ASFWNQFLTWRIFFASMISTFTL 336


>sp|O70496|CLCN7_MOUSE Chloride channel protein 7 OS=Mus musculus
GN=Clcn7 PE=1 SV=1
Length = 803

Score = 101 bits (252), Expect = 2e-21
Identities = 51/143 (35%), Positives = 77/143 (53%)
Frame = +1

Query: 10 YVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTGA 189
++ P AAGSGIP++K +LNG+ +P ++ + L +KV G I SV GGL GK+GP+ H+G+
Sbjct: 194 FIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGS 253

Query: 190 YIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEEV 369
IAA +SQG S + + + +KRD LF+LEE
Sbjct: 254 VIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEG 313

Query: 370 TSWWRNLLLWRVFISTALVAVVL 438
S+W L WR+F ++ + L
Sbjct: 314 ASFWNQFLTWRIFFASMISTFTL 336


>sp|P51798|CLCN7_HUMAN Chloride channel protein 7 OS=Homo sapiens
GN=CLCN7 PE=1 SV=2
Length = 805

Score = 101 bits (252), Expect = 2e-21
Identities = 51/143 (35%), Positives = 77/143 (53%)
Frame = +1

Query: 10 YVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTGA 189
++ P AAGSGIP++K +LNG+ +P ++ + L +KV G I SV GGL GK+GP+ H+G+
Sbjct: 196 FIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGS 255

Query: 190 YIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEEV 369
IAA +SQG S + + + +KRD LF+LEE
Sbjct: 256 VIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEG 315

Query: 370 TSWWRNLLLWRVFISTALVAVVL 438
S+W L WR+F ++ + L
Sbjct: 316 ASFWNQFLTWRIFFASMISTFTL 338


>sp|Q4PKH3|CLCN7_BOVIN Chloride channel protein 7 OS=Bos taurus
GN=CLCN7 PE=2 SV=1
Length = 809

Score = 101 bits (252), Expect = 2e-21
Identities = 51/143 (35%), Positives = 77/143 (53%)
Frame = +1

Query: 10 YVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHTGA 189
++ P AAGSGIP++K +LNG+ +P ++ + L +KV G I SV GGL GK+GP+ H+G+
Sbjct: 200 FIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGS 259

Query: 190 YIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALEEV 369
IAA +SQG S + + + +KRD LF+LEE
Sbjct: 260 VIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEG 319

Query: 370 TSWWRNLLLWRVFISTALVAVVL 438
S+W L WR+F ++ + L
Sbjct: 320 ASFWNQFLTWRIFFASMISTFTL 342


tr_hit_id A7QCB9
Definition tr|A7QCB9|A7QCB9_VITVI Chromosome undetermined scaffold_77, whole genome shotgun sequence OS=Vitis vinifera
Align length 172
Score (bit) 202.0
E-value 1.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913129|Adiantum capillus-veneris mRNA, clone:
YMU001_000026_G08.
(527 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QCB9|A7QCB9_VITVI Chromosome undetermined scaffold_77, whol... 202 1e-50
tr|Q8LPA2|Q8LPA2_ORYSJ Chloride channel OS=Oryza sativa subsp. j... 197 4e-49
tr|A3ASP0|A3ASP0_ORYSJ Putative uncharacterized protein OS=Oryza... 197 4e-49
tr|A2XTU8|A2XTU8_ORYSI Putative uncharacterized protein OS=Oryza... 197 4e-49
tr|Q40485|Q40485_TOBAC C1C-Nt1 protein OS=Nicotiana tabacum GN=C... 196 6e-49
tr|P93567|P93567_SOLTU Chloride channel Stclc1 OS=Solanum tubero... 196 6e-49
tr|A7QR06|A7QR06_VITVI Chromosome undetermined scaffold_147, who... 196 6e-49
tr|Q1SKZ4|Q1SKZ4_MEDTR CBS; Cl-channel, voltage gated; Twin-argi... 195 1e-48
tr|Q5N8W8|Q5N8W8_ORYSJ Putative chloride channel OS=Oryza sativa... 192 9e-48
tr|B8A715|B8A715_ORYSI Putative uncharacterized protein OS=Oryza... 192 9e-48
tr|A3A051|A3A051_ORYSJ Putative uncharacterized protein OS=Oryza... 192 9e-48
tr|Q84QC8|Q84QC8_MAIZE Chloride channel OS=Zea mays PE=2 SV=2 192 1e-47
tr|Q8LPA1|Q8LPA1_ORYSJ Chloride channel (Fragment) OS=Oryza sati... 190 4e-47
tr|Q8LPA0|Q8LPA0_ORYSJ Chloride channel (Fragment) OS=Oryza sati... 190 4e-47
tr|Q6YVX5|Q6YVX5_ORYSJ Os02g0558100 protein OS=Oryza sativa subs... 190 4e-47
tr|B8ADX8|B8ADX8_ORYSI Putative uncharacterized protein OS=Oryza... 190 4e-47
tr|A9RQL6|A9RQL6_PHYPA Predicted protein OS=Physcomitrella paten... 187 3e-46
tr|A7P9T0|A7P9T0_VITVI Chromosome chr14 scaffold_9, whole genome... 186 5e-46
tr|A5AI29|A5AI29_VITVI Putative uncharacterized protein OS=Vitis... 186 5e-46
tr|Q7XTM5|Q7XTM5_ORYSJ Os04g0644800 protein OS=Oryza sativa subs... 186 6e-46
tr|Q2VBU9|Q2VBU9_ORYSJ Chloride channel-like protein Osclc OS=Or... 186 6e-46
tr|Q25A83|Q25A83_ORYSA H0413E07.11 protein OS=Oryza sativa GN=H0... 186 6e-46
tr|A3AY01|A3AY01_ORYSJ Putative uncharacterized protein OS=Oryza... 186 6e-46
tr|A2XY74|A2XY74_ORYSI Putative uncharacterized protein OS=Oryza... 186 6e-46
tr|A9TV34|A9TV34_PHYPA Predicted protein OS=Physcomitrella paten... 185 1e-45
tr|Q0IJ86|Q0IJ86_SOYBN Chloride channel OS=Glycine max PE=2 SV=1 185 1e-45
tr|Q96325|Q96325_ARATH Voltage-gated chloride channel OS=Arabido... 182 7e-45
tr|Q2V324|Q2V324_ARATH Uncharacterized protein At5g40890.2 OS=Ar... 182 7e-45
tr|A9SYH1|A9SYH1_PHYPA Predicted protein OS=Physcomitrella paten... 182 7e-45
tr|Q9XF71|Q9XF71_TOBAC CLC-Nt2 protein OS=Nicotiana tabacum PE=2... 182 1e-44

>tr|A7QCB9|A7QCB9_VITVI Chromosome undetermined scaffold_77, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00035336001 PE=4 SV=1
Length = 777

Score = 202 bits (513), Expect = 1e-50
Identities = 97/172 (56%), Positives = 116/172 (67%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y+ P+AAGSGIPEVKAYLNGID ILAP LFVK+FGSI V+ G GK+GP+ HT
Sbjct: 158 CAYIAPSAAGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSILGVSAGFVVGKEGPMVHT 217

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA+LL QGGS +HL+W WLR KN++D+RDL LFALE
Sbjct: 218 GACIASLLGQGGSRKYHLTWKWLRYFKNDRDRRDLITCGAAAGVAAAFRAPVGGVLFALE 277

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
EVTSWWR+ LLWR F +TA+VAVVLR FC CGL+G GLIM+ + +
Sbjct: 278 EVTSWWRSALLWRTFFTTAVVAVVLRALIEFCRSGKCGLFGQGGLIMFDVNS 329


>tr|Q8LPA2|Q8LPA2_ORYSJ Chloride channel OS=Oryza sativa subsp.
japonica GN=OsCLC-1 PE=2 SV=1
Length = 801

Score = 197 bits (500), Expect = 4e-49
Identities = 95/172 (55%), Positives = 113/172 (65%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y+ PAAAGSGIPEVKAYLNG+D ILAP LFVK+FGSI V+ G GK+GP+ HT
Sbjct: 181 CAYIAPAAAGSGIPEVKAYLNGVDAYSILAPSTLFVKIFGSILGVSAGFVLGKEGPMVHT 240

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS +HL+W WLR KN++D+RDL LFALE
Sbjct: 241 GACIANLLGQGGSRKYHLTWNWLRYFKNDRDRRDLITCGSAAGVAAAFRAPVGGVLFALE 300

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E SWWR+ LLWR F +TA+VAVVLR FC CGL+G GLIM+ + +
Sbjct: 301 EAASWWRSALLWRTFFTTAVVAVVLRGLIEFCRSGKCGLFGQGGLIMFDLSS 352


>tr|A3ASP0|A3ASP0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_013812 PE=4 SV=1
Length = 799

Score = 197 bits (500), Expect = 4e-49
Identities = 95/172 (55%), Positives = 113/172 (65%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y+ PAAAGSGIPEVKAYLNG+D ILAP LFVK+FGSI V+ G GK+GP+ HT
Sbjct: 179 CAYIAPAAAGSGIPEVKAYLNGVDAYSILAPSTLFVKIFGSILGVSAGFVLGKEGPMVHT 238

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS +HL+W WLR KN++D+RDL LFALE
Sbjct: 239 GACIANLLGQGGSRKYHLTWNWLRYFKNDRDRRDLITCGSAAGVAAAFRAPVGGVLFALE 298

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E SWWR+ LLWR F +TA+VAVVLR FC CGL+G GLIM+ + +
Sbjct: 299 EAASWWRSALLWRTFFTTAVVAVVLRGLIEFCRSGKCGLFGQGGLIMFDLSS 350


>tr|A2XTU8|A2XTU8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16029 PE=4 SV=1
Length = 803

Score = 197 bits (500), Expect = 4e-49
Identities = 95/172 (55%), Positives = 113/172 (65%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y+ PAAAGSGIPEVKAYLNG+D ILAP LFVK+FGSI V+ G GK+GP+ HT
Sbjct: 183 CAYIAPAAAGSGIPEVKAYLNGVDAYSILAPSTLFVKIFGSILGVSAGFVLGKEGPMVHT 242

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS +HL+W WLR KN++D+RDL LFALE
Sbjct: 243 GACIANLLGQGGSRKYHLTWNWLRYFKNDRDRRDLITCGSAAGVAAAFRAPVGGVLFALE 302

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E SWWR+ LLWR F +TA+VAVVLR FC CGL+G GLIM+ + +
Sbjct: 303 EAASWWRSALLWRTFFTTAVVAVVLRGLIEFCRSGKCGLFGQGGLIMFDLSS 354


>tr|Q40485|Q40485_TOBAC C1C-Nt1 protein OS=Nicotiana tabacum
GN=C1C-Nt1 PE=2 SV=1
Length = 780

Score = 196 bits (498), Expect = 6e-49
Identities = 95/172 (55%), Positives = 114/172 (66%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C ++ PAAAGSGIPEVKAYLNGID ILAP LFVK+FGS V+ G GK+GP+ HT
Sbjct: 160 CAFIAPAAAGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSALGVSAGFVVGKEGPMVHT 219

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS +HL+W WL+ KN++D+RDL LFALE
Sbjct: 220 GACIANLLGQGGSRKYHLTWKWLKYFKNDRDRRDLITCGAAAGVAAAFRAPVGGVLFALE 279

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
EV SWWR+ LLWR F STA+VA+VLR+ FC CGL+G GLIMY + +
Sbjct: 280 EVASWWRSALLWRTFFSTAVVAMVLRSFIVFCRSGKCGLFGQGGLIMYDVNS 331


>tr|P93567|P93567_SOLTU Chloride channel Stclc1 OS=Solanum tuberosum
PE=2 SV=1
Length = 764

Score = 196 bits (498), Expect = 6e-49
Identities = 93/172 (54%), Positives = 115/172 (66%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C ++ PAAAGSGIPEVKAYLNGID ILAP L VK+FGSI V+ G GK+GP+ HT
Sbjct: 145 CAFIAPAAAGSGIPEVKAYLNGIDAHSILAPSTLLVKIFGSILGVSAGFVVGKEGPMVHT 204

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS +HL+W WL+ KN++D+RDL LFALE
Sbjct: 205 GACIANLLGQGGSRKYHLTWKWLKYFKNDRDRRDLITCGAAAGVAAAFRAPVGGVLFALE 264

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E+ SWWR+ LLWR F +TA+VA+VLR+ FC NCGL+G GLIM+ + +
Sbjct: 265 EIASWWRSALLWRTFFTTAIVAMVLRSLIQFCRGGNCGLFGQGGLIMFDVNS 316


>tr|A7QR06|A7QR06_VITVI Chromosome undetermined scaffold_147, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00003626001 PE=4 SV=1
Length = 742

Score = 196 bits (498), Expect = 6e-49
Identities = 93/170 (54%), Positives = 113/170 (66%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C ++ PAAAGSGIPEVKAYLNGID ILAP LFVK+FGSI V+ G GK+GP+ HT
Sbjct: 125 CAFIAPAAAGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSILGVSAGFVVGKEGPMVHT 184

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA+LL QGGS +HL+W WL+ KN++D+RDL LFALE
Sbjct: 185 GACIASLLGQGGSRKYHLTWSWLKYFKNDQDRRDLITCGAAAGVAAAFRAPVGGVLFALE 244

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSI 513
E SWWR+ LLWR F +TA+VA+VLR +C CGL+G GLIMY +
Sbjct: 245 EAASWWRSALLWRTFFTTAVVAIVLRAFIEYCWTGKCGLFGQGGLIMYDV 294


>tr|Q1SKZ4|Q1SKZ4_MEDTR CBS; Cl-channel, voltage gated;
Twin-arginine translocation pathway signal OS=Medicago
truncatula GN=MtrDRAFT_AC140549g27v2 PE=4 SV=1
Length = 761

Score = 195 bits (495), Expect = 1e-48
Identities = 97/174 (55%), Positives = 114/174 (65%), Gaps = 2/174 (1%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y+ PAAAGSGIPEVKAYLNGID ILAP LFVK+FGSI VA G GK+GP+ HT
Sbjct: 137 CAYIAPAAAGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSILGVAAGFIVGKEGPMVHT 196

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA IA LL QGGS + L+W WLR KN++D+RDL LFALE
Sbjct: 197 GACIANLLGQGGSRKYRLTWKWLRYFKNDRDRRDLITCGAAAGVAAAFRAPVGGVLFALE 256

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFC--GDTNCGLYGHEGLIMYSIGN 519
E SWWR+ LLWR F +TA+VAVVLR+ FC G CGL+G GLIM+ + +
Sbjct: 257 EAASWWRSALLWRTFFTTAVVAVVLRSLMQFCHQGGGRCGLFGEGGLIMFDVNS 310


>tr|Q5N8W8|Q5N8W8_ORYSJ Putative chloride channel OS=Oryza sativa
subsp. japonica GN=P0698A10.31 PE=4 SV=1
Length = 793

Score = 192 bits (488), Expect = 9e-48
Identities = 91/172 (52%), Positives = 112/172 (65%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y GPAAAGSGIPEVKAYLNG+D P ILAP LFVK+ GSI V+ G GK+GP+ HT
Sbjct: 172 CAYFGPAAAGSGIPEVKAYLNGVDAPSILAPSTLFVKIVGSIFGVSAGFVLGKEGPMVHT 231

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA +A+ L QGGS + +W WLR KN+ D+RDL LFALE
Sbjct: 232 GACVASFLGQGGSRKYGFTWNWLRYFKNDLDRRDLITCGAAAGVTAAFRAPVGGVLFALE 291

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E TSWWR+ LLWR F +TA+ A+VLR+ +C NCGL+G GLIM+ + +
Sbjct: 292 EATSWWRSALLWRTFSTTAVAAMVLRSLIEYCRSGNCGLFGKGGLIMFDVSS 343


>tr|B8A715|B8A715_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04638 PE=4 SV=1
Length = 793

Score = 192 bits (488), Expect = 9e-48
Identities = 91/172 (52%), Positives = 112/172 (65%)
Frame = +1

Query: 4 CVYVGPAAAGSGIPEVKAYLNGIDVPDILAPRALFVKVFGSIGSVAGGLDAGKQGPLAHT 183
C Y GPAAAGSGIPEVKAYLNG+D P ILAP LFVK+ GSI V+ G GK+GP+ HT
Sbjct: 172 CAYFGPAAAGSGIPEVKAYLNGVDAPSILAPSTLFVKIVGSIFGVSAGFVLGKEGPMVHT 231

Query: 184 GAYIAALLSQGGSEDHHLSWGWLRSVKNNKDKRDLXXXXXXXXXXXXXXXXXXXXLFALE 363
GA +A+ L QGGS + +W WLR KN+ D+RDL LFALE
Sbjct: 232 GACVASFLGQGGSRKYGFTWNWLRYFKNDLDRRDLITCGAAAGVTAAFRAPVGGVLFALE 291

Query: 364 EVTSWWRNLLLWRVFISTALVAVVLRTASSFCGDTNCGLYGHEGLIMYSIGN 519
E TSWWR+ LLWR F +TA+ A+VLR+ +C NCGL+G GLIM+ + +
Sbjct: 292 EATSWWRSALLWRTFSTTAVAAMVLRSLIEYCRSGNCGLFGKGGLIMFDVSS 343