BP913146
Clone id YMU001_000027_A05
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000027_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACAAACTCCATCAATGAACATCTCAAGCTTCACCCGCCTTTCAAAGCCTCAGTATCCTTT
ACATAACAATATTCTCCTTCTCCATTACAACAATAAATGGCACTAGATTACATCAAAATG
GGTTATCGCTGTAATTGGGGTGGAATCTCAGGGCCCTTATTGTATAAGTCCATCTGGGCC
TCTCTTTATTGCAAGTATTGAATTGTATGTTGGAAAAGCCATACTTAGCTCTCACCTCAA
AGGAACTTGCCTTTGCTGCTTTCACAATGCAAGATGCGAGAGCAATTGGCTTTGCAGTAG
AAGAGCCTCCACACTAATATTATTCTAGCTTGAAAAGAACTCGTCAGCGGAGCCCAGTTA
GGATTTCAAATAGCAAACGACACACTCTGCTTGGGTGGCTCCTCACCTGAACAGGCAGTC
GCGGAGACTATACACTGTACAGTATAATTTAAGCATCATAATGCTTCTCCTCCTCCATAT
ATATGTATACAACAAGCAAAATGTGGAATGTATAAAAGTCTCTTGAAGCTGGTATGCAAT
GGTTTACGCCA
■■Homology search results ■■ -
sp_hit_id Q685J3
Definition sp|Q685J3|MUC17_HUMAN Mucin-17 OS=Homo sapiens
Align length 66
Score (bit) 32.0
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913146|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_A05.
(551 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q685J3|MUC17_HUMAN Mucin-17 OS=Homo sapiens GN=MUC17 PE=1 SV=1 32 2.0

>sp|Q685J3|MUC17_HUMAN Mucin-17 OS=Homo sapiens GN=MUC17 PE=1 SV=1
Length = 4493

Score = 32.0 bits (71), Expect = 2.0
Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 1/66 (1%)
Frame = +2

Query: 131 VIGVESQGPYCISPSGPLFIASIELYVGKAILSSHLKG-TCLCCFHNARCESNWLCSRRA 307
V+ Q PYCISP P F S +GK +S L G CLC S C++
Sbjct: 4329 VVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMS--LSGPQCLCVTTETHWYSGETCNQGT 4386

Query: 308 STLILF 325
+++
Sbjct: 4387 QKSLVY 4392


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913146|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_A05.
(551 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******