BP913158
Clone id YMU001_000027_B05
Library
Length 641
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000027_B05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCCTGCATTGAAAATTCTACCTAGAGAAAACGGATCAGCATTTCTACAGCCCAATAGCC
TAAAACCTCCCTCTGTTTCCCTGCAAATGGCACTTCCCTTCTGCACAGCAGACCCCTGAT
TTGTCGTATCTAGCATGCTCATAATCGACTTGCTAGCTTCTAATGGACTACCACGGATGG
CTCCAAGGTCACTCAGTTCGGATGACTTCAGACACTCCCCCTCCATTTCAATCTCTTCAA
TAGTCTCCAGGCCCCCTTGGCCCACCATATCCAAAGGCGATTCCTCCTCTCTGTGTTGAA
GGATTTCATTAGCTCTTCTTGCCAAGATTTTTCTTTCATGCTCCTTGACATGAGAGCCCA
GACTCAATTCTCCATTTCCTAGACTAAGCTGCTCCTCTCTTATCTTCTTGAGAACAAGCA
CCAAGCGCTCCGGGATGTGCTCACCTGATTCACTAAAATCATGCCTATTGGACTGCACTT
TTGACAAAATAACCCCATTCAGGACAGGCTTCCCTTGTTCCTCTACCTCTTTACTCTGGA
ATGCCACATGCTTTACCAAAGTTGTTTTCTTCACTTTCTCTACATCTCTCGAAACAGAGA
CATCCTCTCCAATACTGTCTCCACTATTACCCACTCGTCGG
■■Homology search results ■■ -
sp_hit_id A5N451
Definition sp|A5N451|MNME_CLOK5 tRNA modification GTPase mnmE OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Align length 43
Score (bit) 31.2
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913158|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_B05.
(641 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A5N451|MNME_CLOK5 tRNA modification GTPase mnmE OS=Clostridiu... 31 4.8

>sp|A5N451|MNME_CLOK5 tRNA modification GTPase mnmE OS=Clostridium
kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
GN=mnmE PE=3 SV=1
Length = 459

Score = 31.2 bits (69), Expect = 4.8
Identities = 15/43 (34%), Positives = 26/43 (60%)
Frame = -2

Query: 619 DSIGEDVSVSRDVEKVKKTTLVKHVAFQSKEVEEQGKPVLNGV 491
D I E + V + EK+ ++ LV + SKE++E+ K ++N V
Sbjct: 285 DDIVEKIGVEKSKEKIDESDLVILMLDSSKELDEEDKEIINYV 327


tr_hit_id A7NTN6
Definition tr|A7NTN6|A7NTN6_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera
Align length 56
Score (bit) 40.8
E-value 0.071
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913158|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_B05.
(641 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NTN6|A7NTN6_VITVI Chromosome chr18 scaffold_1, whole genome... 41 0.071
tr|A5BXA6|A5BXA6_VITVI Putative uncharacterized protein OS=Vitis... 41 0.071
tr|A7R4E4|A7R4E4_VITVI Chromosome undetermined scaffold_670, who... 37 0.78
tr|A5AMA2|A5AMA2_VITVI Putative uncharacterized protein OS=Vitis... 37 0.78
tr|A7R4L8|A7R4L8_VITVI Chromosome undetermined scaffold_741, who... 36 1.7
tr|Q9FGD5|Q9FGD5_ARATH Emb|CAB16785.1 OS=Arabidopsis thaliana GN... 35 5.1
tr|Q2QMU3|Q2QMU3_ORYSJ Os12g0590900 protein OS=Oryza sativa subs... 34 6.6
tr|A3CJ02|A3CJ02_ORYSJ Putative uncharacterized protein OS=Oryza... 34 6.6
tr|A2ZM89|A2ZM89_ORYSI Putative uncharacterized protein OS=Oryza... 34 6.6
tr|B6KHA9|B6KHA9_TOXGO Putative uncharacterized protein OS=Toxop... 34 8.7

>tr|A7NTN6|A7NTN6_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014738001
PE=4 SV=1
Length = 950

Score = 40.8 bits (94), Expect = 0.071
Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
Frame = -2

Query: 172 GSPLEASKSIMSMLDTTNQGSAVQ--KGSAICRETEGGFRLLGCRNADPFSLGRIF 11
G+ S S+ L+ T+ + Q K SAI RETEG FRLLG R + F+ GR F
Sbjct: 647 GTRNRTSASLRGNLENTSMSESCQETKESAIRRETEGEFRLLGRREGNRFAGGRFF 702


>tr|A5BXA6|A5BXA6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009834 PE=4 SV=1
Length = 942

Score = 40.8 bits (94), Expect = 0.071
Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
Frame = -2

Query: 172 GSPLEASKSIMSMLDTTNQGSAVQ--KGSAICRETEGGFRLLGCRNADPFSLGRIF 11
G+ S S+ L+ T+ + Q K SAI RETEG FRLLG R + F+ GR F
Sbjct: 639 GTRNRTSASLXGNLENTSMSESCQETKESAIRRETEGEFRLLGRREGNRFAGGRFF 694


>tr|A7R4E4|A7R4E4_VITVI Chromosome undetermined scaffold_670, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004344001 PE=4 SV=1
Length = 938

Score = 37.4 bits (85), Expect = 0.78
Identities = 20/30 (66%), Positives = 21/30 (70%)
Frame = -2

Query: 100 KGSAICRETEGGFRLLGCRNADPFSLGRIF 11
K SAI RETEG FRLLG R + FS GR F
Sbjct: 667 KESAIRRETEGEFRLLGRREGNRFSGGRFF 696


>tr|A5AMA2|A5AMA2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_039637 PE=4 SV=1
Length = 1281

Score = 37.4 bits (85), Expect = 0.78
Identities = 20/30 (66%), Positives = 21/30 (70%)
Frame = -2

Query: 100 KGSAICRETEGGFRLLGCRNADPFSLGRIF 11
K SAI RETEG FRLLG R + FS GR F
Sbjct: 1010 KESAIRRETEGEFRLLGRREGNRFSGGRFF 1039


>tr|A7R4L8|A7R4L8_VITVI Chromosome undetermined scaffold_741, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004577001 PE=4 SV=1
Length = 938

Score = 36.2 bits (82), Expect = 1.7
Identities = 19/30 (63%), Positives = 21/30 (70%)
Frame = -2

Query: 100 KGSAICRETEGGFRLLGCRNADPFSLGRIF 11
K SAI RETEG FRLLG R + F+ GR F
Sbjct: 667 KESAIRRETEGEFRLLGRREGNRFAGGRFF 696


>tr|Q9FGD5|Q9FGD5_ARATH Emb|CAB16785.1 OS=Arabidopsis thaliana
GN=At5g66950 PE=4 SV=1
Length = 870

Score = 34.7 bits (78), Expect = 5.1
Identities = 19/36 (52%), Positives = 23/36 (63%)
Frame = -2

Query: 121 NQGSAVQKGSAICRETEGGFRLLGCRNADPFSLGRI 14
N S+ K SAI RETEG FRLLG R ++ GR+
Sbjct: 606 NGSSSGIKDSAIRRETEGEFRLLGRREKSQYNGGRL 641


>tr|Q2QMU3|Q2QMU3_ORYSJ Os12g0590900 protein OS=Oryza sativa subsp.
japonica GN=Os12g0590900 PE=2 SV=1
Length = 908

Score = 34.3 bits (77), Expect = 6.6
Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
Frame = -2

Query: 115 GSAVQKGSAICRETEGGFRLLGCRNADP-FSLGRIF 11
G K SAI RETEG FRLLG R+ + F+ GR+F
Sbjct: 625 GGGDHKESAIRRETEGEFRLLGGRDGNSRFAGGRLF 660


>tr|A3CJ02|A3CJ02_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_035274 PE=4 SV=1
Length = 768

Score = 34.3 bits (77), Expect = 6.6
Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
Frame = -2

Query: 115 GSAVQKGSAICRETEGGFRLLGCRNADP-FSLGRIF 11
G K SAI RETEG FRLLG R+ + F+ GR+F
Sbjct: 485 GGGDHKESAIRRETEGEFRLLGGRDGNSRFAGGRLF 520


>tr|A2ZM89|A2ZM89_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38943 PE=4 SV=1
Length = 830

Score = 34.3 bits (77), Expect = 6.6
Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
Frame = -2

Query: 115 GSAVQKGSAICRETEGGFRLLGCRNADP-FSLGRIF 11
G K SAI RETEG FRLLG R+ + F+ GR+F
Sbjct: 547 GGGDHKESAIRRETEGEFRLLGGRDGNSRFAGGRLF 582


>tr|B6KHA9|B6KHA9_TOXGO Putative uncharacterized protein
OS=Toxoplasma gondii ME49 GN=TGME49_048860 PE=4 SV=1
Length = 464

Score = 33.9 bits (76), Expect = 8.7
Identities = 30/89 (33%), Positives = 41/89 (46%)
Frame = +3

Query: 258 WPTISKGDSSSLC*RISLALLAKIFLSCSLT*EPRLNSPFPRLSCSSLIFLRTSTKRSGM 437
WP +GDS+S R+ L+ +F + +L EP SPF L SSL +S S +
Sbjct: 203 WPP-QRGDSTSPPPRVPLSSRLSLFSALAL--EPSFFSPFIALPSSSLSSFASS---SSL 256

Query: 438 CSPDSLKSCLLDCTFDKITPFRTGFPCSS 524
CS + S C + FPCSS
Sbjct: 257 CSSSAPCSSSAPC---------SSFPCSS 276