BP913172
Clone id YMU001_000027_C09
Library
Length 525
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000027_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGTCAGAGTGGTTTAATAAGTCGGCTTTGAAGCCCGAAGTATGGTGGCTTTCTGACATTT
GGCTCTCTTGCTAGTGGCAAGGAATCAGCCTCTGGACAGCCAACTCTATCAGATTTGAGA
AATATCTATAGCCTTGGACGTGTAAATAGACAGACAAAGGTCTTTGGAATCATTGGAAAA
CCTGTGGGGCATAGTAGAAGCCCCATCATACACAATGCTGCATTTCGAGAAATTGGTTAT
GATGGCATATATGTTCCTTTACTCGTGGACAACTTGAGAGAGTTTTTGAATGTCTATAAC
ACCTCAGATTTCAGTGGATTCAGTGTGACAATCCCTCACAAGGAAGCGGTCCTTGAGTGT
TGTGATGAAGTTGATCCACTTGCCAAGGCTGTAGGTGCTGTAAATACAATTGTTAGGCGG
AAGAGTGATGGGAAACTGATTGGTTACAACACTGACTGTGAAGGCGCTATTTCTGCAATA
GAGGATGGCCTACGAGGAGGAGAGAGTAATACCACTGATAAGTCA
■■Homology search results ■■ -
sp_hit_id Q9SQT8
Definition sp|Q9SQT8|DHQSD_ARATH Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic OS=Arabidopsis thaliana
Align length 165
Score (bit) 238.0
E-value 2.0e-62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913172|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_C09.
(525 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SQT8|DHQSD_ARATH Bifunctional 3-dehydroquinate dehydratase/... 238 2e-62
sp|O26344|AROE_METTH Shikimate dehydrogenase OS=Methanobacterium... 106 8e-23
sp|Q6HDI8|AROE_BACHK Shikimate dehydrogenase OS=Bacillus thuring... 106 8e-23
sp|Q634K8|AROE_BACCZ Shikimate dehydrogenase OS=Bacillus cereus ... 106 8e-23
sp|Q818D0|AROE_BACCR Shikimate dehydrogenase OS=Bacillus cereus ... 106 8e-23
sp|Q730K1|AROE_BACC1 Shikimate dehydrogenase OS=Bacillus cereus ... 106 8e-23
sp|A4J3A0|AROE_DESRM Shikimate dehydrogenase OS=Desulfotomaculum... 105 1e-22
sp|A0RIV1|AROE_BACAH Shikimate dehydrogenase OS=Bacillus thuring... 104 3e-22
sp|Q8YVC1|AROE_ANASP Shikimate dehydrogenase OS=Anabaena sp. (st... 104 3e-22
sp|Q58484|AROE_METJA Shikimate dehydrogenase OS=Methanocaldococc... 103 4e-22
sp|A7GT28|AROE_BACCN Shikimate dehydrogenase OS=Bacillus cereus ... 103 4e-22
sp|Q3M8H2|AROE_ANAVT Shikimate dehydrogenase OS=Anabaena variabi... 103 5e-22
sp|Q8U0A6|AROE_PYRFU Shikimate dehydrogenase OS=Pyrococcus furio... 101 2e-21
sp|Q8TZ24|AROE_METKA Shikimate dehydrogenase OS=Methanopyrus kan... 101 2e-21
sp|A5UMF6|AROE_METS3 Shikimate dehydrogenase OS=Methanobrevibact... 100 6e-21
sp|Q39VU8|AROE_GEOMG Shikimate dehydrogenase OS=Geobacter metall... 100 6e-21
sp|Q8RAG2|AROE_THETN Shikimate dehydrogenase OS=Thermoanaerobact... 98 3e-20
sp|Q5WHI2|AROE_BACSK Shikimate dehydrogenase OS=Bacillus clausii... 98 3e-20
sp|A6TM69|AROE_ALKMQ Shikimate dehydrogenase OS=Alkaliphilus met... 98 3e-20
sp|A8MEE1|AROE_ALKOO Shikimate dehydrogenase OS=Alkaliphilus ore... 97 4e-20
sp|Q9V1H7|AROE_PYRAB Shikimate dehydrogenase OS=Pyrococcus abyss... 97 5e-20
sp|A6VFM7|AROE_METM7 Shikimate dehydrogenase OS=Methanococcus ma... 97 6e-20
sp|Q2VYH4|AROE_MAGMM Shikimate dehydrogenase OS=Magnetospirillum... 96 8e-20
sp|P54374|AROE_BACSU Shikimate dehydrogenase OS=Bacillus subtili... 96 8e-20
sp|Q6LYQ2|AROE_METMP Shikimate dehydrogenase OS=Methanococcus ma... 95 2e-19
sp|Q3AEF5|AROE_CARHZ Shikimate dehydrogenase OS=Carboxydothermus... 95 2e-19
sp|Q74D29|AROE_GEOSL Shikimate dehydrogenase OS=Geobacter sulfur... 93 7e-19
sp|A0LLU7|AROE_SYNFM Shikimate dehydrogenase OS=Syntrophobacter ... 93 9e-19
sp|Q1AWA3|AROE_RUBXD Shikimate dehydrogenase OS=Rubrobacter xyla... 92 2e-18
sp|Q30VD9|AROE_DESDG Shikimate dehydrogenase OS=Desulfovibrio de... 92 2e-18

>sp|Q9SQT8|DHQSD_ARATH Bifunctional 3-dehydroquinate
dehydratase/shikimate dehydrogenase, chloroplastic
OS=Arabidopsis thaliana GN=EMB3004 PE=1 SV=1
Length = 603

Score = 238 bits (606), Expect = 2e-62
Identities = 110/165 (66%), Positives = 138/165 (83%)
Frame = +1

Query: 1 GQSGLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGK 180
G+ GL+SR+ K+GG+LTFG+L S K SA GQPT+ DL ++Y+ R+ TKV+GIIGK
Sbjct: 272 GERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIGK 331

Query: 181 PVGHSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLEC 360
PV HS+SPI+HN AF+ + ++G+YV LLVDNL FL Y++SDF+GFS TIPHKEA L+C
Sbjct: 332 PVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQC 391

Query: 361 CDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLR 495
CDEVDPLAK++GAVNTI+RRKSDGKL+GYNTDC G+ISAIEDGLR
Sbjct: 392 CDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLR 436


>sp|O26344|AROE_METTH Shikimate dehydrogenase OS=Methanobacterium
thermoautotrophicum GN=aroE PE=3 SV=2
Length = 283

Score = 106 bits (264), Expect = 8e-23
Identities = 56/117 (47%), Positives = 75/117 (64%), Gaps = 2/117 (1%)
Frame = +1

Query: 142 VNRQTKVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLV--DNLREFLNVYNTSDFS 315
+ +T V GI+G P+GHS SPI+HNAAFR +G D IYVP V +NL+ +
Sbjct: 2 ITGKTHVTGIMGHPLGHSLSPIMHNAAFRSLGMDWIYVPFPVKPENLKAAVEGLRALGVE 61

Query: 316 GFSVTIPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIED 486
G +VTIPHKEAVLE D++ A +GAVNT+ + DG + GYNTD G + A+E+
Sbjct: 62 GVNVTIPHKEAVLEYIDDIHGTAALIGAVNTL--KFDDGTVRGYNTDASGCLRALEE 116


>sp|Q6HDI8|AROE_BACHK Shikimate dehydrogenase OS=Bacillus
thuringiensis subsp. konkukian GN=aroE PE=3 SV=1
Length = 277

Score = 106 bits (264), Expect = 8e-23
Identities = 53/111 (47%), Positives = 73/111 (65%), Gaps = 2/111 (1%)
Frame = +1

Query: 157 KVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLVDN--LREFLNVYNTSDFSGFSVT 330
+++G+IG P+GHS SP++HN AF + D Y LV L E + SGF+VT
Sbjct: 3 QLYGVIGNPIGHSLSPVMHNDAFEHLNMDAHYHAFLVKEEVLGEAVRGLKALGISGFNVT 62

Query: 331 IPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIE 483
PHK A+++ DE+DPLAK +GAVNT+V + DGKLIGYNTD G + A++
Sbjct: 63 TPHKVAIMDYLDEIDPLAKQIGAVNTVVHK--DGKLIGYNTDGIGFVRALQ 111


>sp|Q634K8|AROE_BACCZ Shikimate dehydrogenase OS=Bacillus cereus
(strain ZK / E33L) GN=aroE PE=3 SV=1
Length = 277

Score = 106 bits (264), Expect = 8e-23
Identities = 53/111 (47%), Positives = 73/111 (65%), Gaps = 2/111 (1%)
Frame = +1

Query: 157 KVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLVDN--LREFLNVYNTSDFSGFSVT 330
+++G+IG P+GHS SP++HN AF + D Y LV L E + SGF+VT
Sbjct: 3 QLYGVIGNPIGHSLSPVMHNDAFEHLNMDAHYHAFLVKEEVLGEAVRGLKALGISGFNVT 62

Query: 331 IPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIE 483
PHK A+++ DE+DPLAK +GAVNT+V + DGKLIGYNTD G + A++
Sbjct: 63 TPHKVAIMDYLDEIDPLAKQIGAVNTVVHK--DGKLIGYNTDGIGFVRALQ 111


>sp|Q818D0|AROE_BACCR Shikimate dehydrogenase OS=Bacillus cereus
(strain ATCC 14579 / DSM 31) GN=aroE PE=3 SV=1
Length = 277

Score = 106 bits (264), Expect = 8e-23
Identities = 52/111 (46%), Positives = 74/111 (66%), Gaps = 2/111 (1%)
Frame = +1

Query: 157 KVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLVDN--LREFLNVYNTSDFSGFSVT 330
+++G+IG P+GHS SP++HN AF + D Y LV+ L E + SGF+VT
Sbjct: 3 QLYGVIGNPIGHSLSPVMHNDAFEHLNMDAHYHAFLVEEELLGEAVRGLKALGISGFNVT 62

Query: 331 IPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIE 483
PHK A++E DE+DPLA+ +GAVNT+V + DG+LIGYNTD G + A++
Sbjct: 63 TPHKVAIMEYLDEIDPLARKIGAVNTVVHK--DGRLIGYNTDGIGFVRALQ 111


>sp|Q730K1|AROE_BACC1 Shikimate dehydrogenase OS=Bacillus cereus
(strain ATCC 10987) GN=aroE PE=3 SV=1
Length = 277

Score = 106 bits (264), Expect = 8e-23
Identities = 53/111 (47%), Positives = 73/111 (65%), Gaps = 2/111 (1%)
Frame = +1

Query: 157 KVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLVDN--LREFLNVYNTSDFSGFSVT 330
+++G+IG P+GHS SP++HN AF + D Y LV L E + SGF+VT
Sbjct: 3 QLYGVIGNPIGHSLSPVMHNDAFEHLNMDAHYHAFLVKEEVLGEAVRGLKALGISGFNVT 62

Query: 331 IPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIE 483
PHK A+++ DE+DPLAK +GAVNT+V + DGKLIGYNTD G + A++
Sbjct: 63 TPHKVAIMDYLDEIDPLAKQIGAVNTVVHK--DGKLIGYNTDGIGFVRALQ 111


>sp|A4J3A0|AROE_DESRM Shikimate dehydrogenase OS=Desulfotomaculum
reducens (strain MI-1) GN=aroE PE=3 SV=1
Length = 291

Score = 105 bits (262), Expect = 1e-22
Identities = 53/121 (43%), Positives = 83/121 (68%), Gaps = 2/121 (1%)
Frame = +1

Query: 139 RVNRQTKVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLV--DNLREFLNVYNTSDF 312
R+N +T+V G+ G PV HS SP +HNAAF+++ + YVP V DNL++ + + +
Sbjct: 5 RINGKTQVCGLFGFPVEHSFSPAMHNAAFQQLDLNWTYVPFRVHPDNLKQAVTGIFSLNM 64

Query: 313 SGFSVTIPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGL 492
+G +VT+PHK+ V+ DE++P A+ +GAVNTIV ++GKL+GYNTD +G + A+ +
Sbjct: 65 AGVNVTVPHKQRVMPFLDELEPAARIIGAVNTIV--NNNGKLVGYNTDGKGFVRALTEEA 122

Query: 493 R 495
R
Sbjct: 123 R 123


>sp|A0RIV1|AROE_BACAH Shikimate dehydrogenase OS=Bacillus
thuringiensis (strain Al Hakam) GN=aroE PE=3 SV=1
Length = 277

Score = 104 bits (259), Expect = 3e-22
Identities = 52/111 (46%), Positives = 73/111 (65%), Gaps = 2/111 (1%)
Frame = +1

Query: 157 KVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLVDN--LREFLNVYNTSDFSGFSVT 330
+++G+IG P+GHS SP++HN AF + D Y LV L E + SGF+VT
Sbjct: 3 QLYGVIGNPIGHSLSPVMHNDAFEHLNMDAHYHAFLVKEEVLGEAVRGLKALGISGFNVT 62

Query: 331 IPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIE 483
PHK A+++ DE+DPLAK +GAVNT+V + +GKLIGYNTD G + A++
Sbjct: 63 TPHKVAIMDYLDEIDPLAKQIGAVNTVVHK--NGKLIGYNTDGIGFVRALQ 111


>sp|Q8YVC1|AROE_ANASP Shikimate dehydrogenase OS=Anabaena sp.
(strain PCC 7120) GN=aroE PE=3 SV=1
Length = 289

Score = 104 bits (259), Expect = 3e-22
Identities = 50/116 (43%), Positives = 78/116 (67%), Gaps = 2/116 (1%)
Frame = +1

Query: 142 VNRQTKVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYVPLLV--DNLREFLNVYNTSDFS 315
+ +TK+ G+IG PV HS SP++HNAA ++G D +Y+P + DNL + + T
Sbjct: 2 ITGKTKLLGVIGHPVEHSLSPVMHNAAIAQLGLDYVYLPFPIAPDNLEAAIALLATIGVV 61

Query: 316 GFSVTIPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIE 483
GFSVTIPHK+A++ E+ P+A+A+GAVNT+ R+ + + +G NTD EG I+ ++
Sbjct: 62 GFSVTIPHKQAIIPLLSEISPVAQAIGAVNTVTRQ--NNQWVGTNTDIEGFIAPLQ 115


>sp|Q58484|AROE_METJA Shikimate dehydrogenase OS=Methanocaldococcus
jannaschii GN=aroE PE=1 SV=1
Length = 282

Score = 103 bits (258), Expect = 4e-22
Identities = 56/117 (47%), Positives = 79/117 (67%), Gaps = 2/117 (1%)
Frame = +1

Query: 142 VNRQTKVFGIIGKPVGHSRSPIIHNAAFREIGYDGIYV--PLLVDNLREFLNVYNTSDFS 315
+N +TKV G+IG PV HS SPI+HNAAF++ G + +YV +L +NL+ ++
Sbjct: 2 INAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIV 61

Query: 316 GFSVTIPHKEAVLECCDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIED 486
GF+VTIPHK +++ DE+D A+ +GAVNTI + DGK IGYNTD GA A+E+
Sbjct: 62 GFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTI--KIEDGKAIGYNTDGIGARMALEE 116


tr_hit_id A9NUR4
Definition tr|A9NUR4|A9NUR4_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 166
Score (bit) 246.0
E-value 5.0e-64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913172|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_C09.
(525 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUR4|A9NUR4_PICSI Putative uncharacterized protein OS=Picea... 246 5e-64
tr|B8LLR2|B8LLR2_PICSI Putative uncharacterized protein OS=Picea... 244 2e-63
tr|B6TSW1|B6TSW1_MAIZE Shikimate dehydrogenase OS=Zea mays PE=2 ... 238 2e-61
tr|B4FH30|B4FH30_MAIZE Putative uncharacterized protein OS=Zea m... 237 2e-61
tr|B4FAK2|B4FAK2_MAIZE Putative uncharacterized protein OS=Zea m... 237 2e-61
tr|A7XEE1|A7XEE1_9ROSI 3-dehydroquinate dehydratase/shikimate 5-... 234 2e-60
tr|B8BM99|B8BM99_ORYSI Putative uncharacterized protein OS=Oryza... 229 8e-59
tr|A7NW96|A7NW96_VITVI Chromosome chr5 scaffold_2, whole genome ... 221 2e-56
tr|A3CI14|A3CI14_ORYSJ Putative uncharacterized protein OS=Oryza... 217 3e-55
tr|O65917|O65917_SOLLC Dehydroquinate dehydratase/shikimate:NADP... 211 2e-53
tr|A5ATW0|A5ATW0_VITVI Putative uncharacterized protein OS=Vitis... 209 5e-53
tr|Q6PUF9|Q6PUF9_TOBAC 3-dehydroquinate dehydratase / shikimate ... 208 1e-52
tr|Q42947|Q42947_TOBAC Dehydroquinate dehydratase/shikimate dehy... 208 1e-52
tr|Q6PUG0|Q6PUG0_TOBAC 3-dehydroquinate dehydratase / shikimate ... 207 3e-52
tr|B4FN22|B4FN22_MAIZE Putative uncharacterized protein OS=Zea m... 206 4e-52
tr|A7QX07|A7QX07_VITVI Chromosome chr14 scaffold_211, whole geno... 206 8e-52
tr|A5ATW2|A5ATW2_VITVI Putative uncharacterized protein OS=Vitis... 206 8e-52
tr|A9S495|A9S495_PHYPA Predicted protein OS=Physcomitrella paten... 202 1e-50
tr|Q30D00|Q30D00_FAGSY Putative 3-dehydroquinate dehydratase/shi... 201 1e-50
tr|A7QX08|A7QX08_VITVI Chromosome chr14 scaffold_211, whole geno... 197 3e-49
tr|Q5ZCV1|Q5ZCV1_ORYSJ Putative dehydroquinate dehydratase (Puta... 196 5e-49
tr|Q0JMN6|Q0JMN6_ORYSJ Os01g0375200 protein (Fragment) OS=Oryza ... 196 5e-49
tr|B6UCV5|B6UCV5_MAIZE Shikimate biosynthesis protein aroDE OS=Z... 196 8e-49
tr|B8A8A3|B8A8A3_ORYSI Putative uncharacterized protein OS=Oryza... 194 2e-48
tr|A2WQ65|A2WQ65_ORYSI Putative uncharacterized protein OS=Oryza... 194 3e-48
tr|Q5ZCU7|Q5ZCU7_ORYSJ Putative dehydroquinate dehydratase OS=Or... 192 9e-48
tr|Q0JMN4|Q0JMN4_ORYSJ Os01g0375500 protein OS=Oryza sativa subs... 192 9e-48
tr|A2ZTB4|A2ZTB4_ORYSJ Putative uncharacterized protein OS=Oryza... 192 9e-48
tr|A4S5X6|A4S5X6_OSTLU Predicted protein OS=Ostreococcus lucimar... 177 3e-43
tr|A8IZ72|A8IZ72_CHLRE Dehydroquinate dehydratase OS=Chlamydomon... 176 8e-43

>tr|A9NUR4|A9NUR4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 514

Score = 246 bits (628), Expect = 5e-64
Identities = 113/166 (68%), Positives = 138/166 (83%)
Frame = +1

Query: 1 GQSGLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGK 180
G GLIS+L PK+GG+L +GS+ SGK+S GQP L+DL Y +GR+N TKVFG+I
Sbjct: 183 GDRGLISQLLGPKFGGYLIYGSIGSGKDSTPGQPKLADLTGHYKIGRLNSDTKVFGVIAN 242

Query: 181 PVGHSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLEC 360
PVGHS+ PI+HN AFR+ G++G+YVPLLVDNL +FL VY+ DF+GFSV IPHKEA + C
Sbjct: 243 PVGHSKGPILHNQAFRDAGFNGVYVPLLVDNLADFLKVYSAPDFAGFSVGIPHKEAAVTC 302

Query: 361 CDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRG 498
CDEV PLA+++GAVNTIVRR+SDGKLIGYNTDCEGAISAIEDGL+G
Sbjct: 303 CDEVQPLAQSIGAVNTIVRRQSDGKLIGYNTDCEGAISAIEDGLKG 348


>tr|B8LLR2|B8LLR2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 518

Score = 244 bits (623), Expect = 2e-63
Identities = 115/165 (69%), Positives = 139/165 (84%)
Frame = +1

Query: 4 QSGLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGKP 183
+ GLISRL PK+GG+LTFGSL +GKESA GQ TL+D+ NIY + + R TKVFG+IG P
Sbjct: 188 ERGLISRLLCPKFGGYLTFGSLEAGKESAPGQATLADMLNIYKIRGLGRDTKVFGLIGNP 247

Query: 184 VGHSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLECC 363
V HS+ P +HN AF EIG+D IYVP LVD+++EFL VY++ DF+GFSVTIPHKEA LECC
Sbjct: 248 VSHSKGPTLHNRAFGEIGFDAIYVPFLVDDIKEFLKVYSSPDFAGFSVTIPHKEAALECC 307

Query: 364 DEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRG 498
DEVDP+A+++GAVNTIVRR+SDGKLIGYNTD GAISAIED L+G
Sbjct: 308 DEVDPIARSIGAVNTIVRRQSDGKLIGYNTDSVGAISAIEDALKG 352


>tr|B6TSW1|B6TSW1_MAIZE Shikimate dehydrogenase OS=Zea mays PE=2
SV=1
Length = 540

Score = 238 bits (606), Expect = 2e-61
Identities = 112/170 (65%), Positives = 138/170 (81%)
Frame = +1

Query: 10 GLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGKPVG 189
G ISR+ PKYGGFLTFGSL GKESA QPT +DL N+Y++ ++ TKVFGIIGKPVG
Sbjct: 204 GFISRVLCPKYGGFLTFGSLKKGKESAPAQPTAADLINLYNIRQIGPDTKVFGIIGKPVG 263

Query: 190 HSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLECCDE 369
HS+SPI+HN AFR +G++ +YVP LVD+L +FL+ Y++ DF+GFS TIPHKEA + CCDE
Sbjct: 264 HSKSPILHNEAFRSVGFNAVYVPFLVDDLAKFLDTYSSPDFAGFSCTIPHKEAAVRCCDE 323

Query: 370 VDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRGGESNTTD 519
VDP+A+ +GAVNTIVRR DGKL+GYNTD GAISAIEDG++ ES TD
Sbjct: 324 VDPIARDIGAVNTIVRR-PDGKLVGYNTDYVGAISAIEDGIKASESEPTD 372


>tr|B4FH30|B4FH30_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 428

Score = 237 bits (605), Expect = 2e-61
Identities = 112/170 (65%), Positives = 138/170 (81%)
Frame = +1

Query: 10 GLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGKPVG 189
G ISR+ PKYGGFLTFGSL GKESA QPT +DL N+Y++ ++ TKVFGIIGKPVG
Sbjct: 101 GFISRVLCPKYGGFLTFGSLKKGKESAPAQPTAADLINLYNIRQIGPDTKVFGIIGKPVG 160

Query: 190 HSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLECCDE 369
HS+SPI+HN AFR +G++ +YVP LVD+L +FL+ Y++ DF+GFS TIPHKEA + CCDE
Sbjct: 161 HSKSPILHNEAFRSVGFNAVYVPFLVDDLAKFLDTYSSPDFAGFSCTIPHKEAAVRCCDE 220

Query: 370 VDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRGGESNTTD 519
VDP+A+ +GAVNTIVRR DGKL+GYNTD GAISAIEDG++ ES TD
Sbjct: 221 VDPVARDIGAVNTIVRR-PDGKLVGYNTDYVGAISAIEDGIKASESEPTD 269


>tr|B4FAK2|B4FAK2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 543

Score = 237 bits (605), Expect = 2e-61
Identities = 112/170 (65%), Positives = 138/170 (81%)
Frame = +1

Query: 10 GLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGKPVG 189
G ISR+ PKYGGFLTFGSL GKESA QPT +DL N+Y++ ++ TKVFGIIGKPVG
Sbjct: 207 GFISRVLCPKYGGFLTFGSLKKGKESAPAQPTAADLINLYNIRQIGPDTKVFGIIGKPVG 266

Query: 190 HSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLECCDE 369
HS+SPI+HN AFR +G++ +YVP LVD+L +FL+ Y++ DF+GFS TIPHKEA + CCDE
Sbjct: 267 HSKSPILHNEAFRSVGFNAVYVPFLVDDLAKFLDTYSSPDFAGFSCTIPHKEAAVRCCDE 326

Query: 370 VDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRGGESNTTD 519
VDP+A+ +GAVNTIVRR DGKL+GYNTD GAISAIEDG++ ES TD
Sbjct: 327 VDPVARDIGAVNTIVRR-PDGKLVGYNTDYVGAISAIEDGIKASESEPTD 375


>tr|A7XEE1|A7XEE1_9ROSI 3-dehydroquinate dehydratase/shikimate
5-dehydrogenase (Fragment) OS=Juglans regia PE=2 SV=1
Length = 508

Score = 234 bits (597), Expect = 2e-60
Identities = 109/175 (62%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
Frame = +1

Query: 1 GQSGLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGK 180
G+ G +SR+ PK+GGFLTFG++ SG SA GQPT+ DL ++Y+L R+ TKVFGIIGK
Sbjct: 179 GERGFMSRILCPKFGGFLTFGTIESGIVSAPGQPTMKDLLHLYNLRRIGPDTKVFGIIGK 238

Query: 181 PVGHSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLEC 360
PV HS+SPI++N AF+ + ++G+Y+PLLVD++ FL Y+++DF+GFS TIPHKEA L+C
Sbjct: 239 PVHHSKSPILYNEAFKSVCFNGVYIPLLVDDIANFLQTYSSTDFAGFSCTIPHKEAALKC 298

Query: 361 CDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRG--GESNTTD 519
CDEVDP+AK++GAVN I+RR +DGKL+GYNTD GAISAIEDGLRG SNT D
Sbjct: 299 CDEVDPVAKSIGAVNCIIRRPTDGKLVGYNTDYVGAISAIEDGLRGSHNSSNTAD 353


>tr|B8BM99|B8BM99_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38581 PE=4 SV=1
Length = 531

Score = 229 bits (583), Expect = 8e-59
Identities = 107/172 (62%), Positives = 136/172 (79%)
Frame = +1

Query: 10 GLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGKPVG 189
G ISR+ PK+GG+LTFGSL GKESA QPT++DL N+Y++ ++ TKV+GIIGKPVG
Sbjct: 205 GFISRVLCPKFGGYLTFGSLEKGKESAPAQPTVTDLINVYNIKQIGPDTKVYGIIGKPVG 264

Query: 190 HSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLECCDE 369
HS+SPI+HN AFR +G + +YVP LVD+L FLN Y++ +F+GFS TIPHKEA + CCDE
Sbjct: 265 HSKSPILHNEAFRSVGLNAVYVPFLVDDLANFLNTYSSPEFAGFSCTIPHKEAAVRCCDE 324

Query: 370 VDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRGGESNTTDKS 525
VDP+AK +GAVNTI+ RK +GKL+GYNTD GAISAIEDG+R + T S
Sbjct: 325 VDPIAKDIGAVNTII-RKPNGKLVGYNTDYVGAISAIEDGIRASQPTDTTTS 375


>tr|A7NW96|A7NW96_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019835001
PE=4 SV=1
Length = 495

Score = 221 bits (562), Expect = 2e-56
Identities = 102/165 (61%), Positives = 132/165 (80%)
Frame = +1

Query: 1 GQSGLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGK 180
G+ GLISR+ PK+ G+LTFGSL G SA GQPT+ DL N+Y+ ++ TKVFG+IGK
Sbjct: 165 GERGLISRILCPKFSGYLTFGSLEPGIVSAPGQPTIKDLLNLYNFRQLGPDTKVFGVIGK 224

Query: 181 PVGHSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLEC 360
PV HS+SP ++N AF+ +G++G+YV LLVD++ +F + Y+ +DF+GFS TIPHKEA L+C
Sbjct: 225 PVSHSKSPHLYNEAFKSVGFNGVYVHLLVDDIAKFFHTYSAADFAGFSCTIPHKEAALKC 284

Query: 361 CDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLR 495
CDEV P+AK++GAVN I+RR SDGKL GYNTD GAISAIEDGLR
Sbjct: 285 CDEVSPVAKSIGAVNCIIRRPSDGKLFGYNTDYVGAISAIEDGLR 329


>tr|A3CI14|A3CI14_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034936 PE=3 SV=1
Length = 865

Score = 217 bits (552), Expect = 3e-55
Identities = 107/192 (55%), Positives = 136/192 (70%), Gaps = 20/192 (10%)
Frame = +1

Query: 10 GLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGKPVG 189
G ISR+ PK+GG+LTFGSL GKESA QPT++DL N+Y++ ++ TKV+GIIGKPVG
Sbjct: 200 GFISRVLCPKFGGYLTFGSLEKGKESAPAQPTVTDLINVYNIKQIGPDTKVYGIIGKPVG 259

Query: 190 HSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLECCDE 369
HS+SPI+HN AFR +G + +YVP LVD+L FLN Y++ +F+GFS TIPHKEA + CCDE
Sbjct: 260 HSKSPILHNEAFRSVGLNAVYVPFLVDDLANFLNTYSSPEFAGFSCTIPHKEAAVRCCDE 319

Query: 370 VDPLAK--------------------AVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDG 489
VDP+AK +GAVNTI+ RK +GKL+GYNTD GAISAIEDG
Sbjct: 320 VDPIAKDILEPFNKSRVTFVSNNFVQDIGAVNTII-RKPNGKLVGYNTDYVGAISAIEDG 378

Query: 490 LRGGESNTTDKS 525
+R + T S
Sbjct: 379 IRASQPTDTTTS 390


>tr|O65917|O65917_SOLLC Dehydroquinate dehydratase/shikimate:NADP
oxidoreductase OS=Solanum lycopersicum PE=2 SV=1
Length = 545

Score = 211 bits (536), Expect = 2e-53
Identities = 97/168 (57%), Positives = 132/168 (78%)
Frame = +1

Query: 1 GQSGLISRL*SPKYGGFLTFGSLASGKESASGQPTLSDLRNIYSLGRVNRQTKVFGIIGK 180
G+ GL+SR+ PK+GG+LTFG+L GK SA GQPT+ DL N+Y+ ++ TK+FGIIGK
Sbjct: 219 GEKGLMSRILCPKFGGYLTFGTLEVGKVSAPGQPTVEDLLNLYNFRQLGPDTKIFGIIGK 278

Query: 181 PVGHSRSPIIHNAAFREIGYDGIYVPLLVDNLREFLNVYNTSDFSGFSVTIPHKEAVLEC 360
PV HS+SP+++N +FR +G++G+++ LLVD++ F Y++ DF+GFS TIPHKEA L+C
Sbjct: 279 PVSHSKSPLLYNESFRSVGFNGVFMHLLVDDIANFFRTYSSLDFAGFSCTIPHKEAALDC 338

Query: 361 CDEVDPLAKAVGAVNTIVRRKSDGKLIGYNTDCEGAISAIEDGLRGGE 504
C E+DP AKA+GAVN I+RR DGKL G NTD GAISAIE+GL+G +
Sbjct: 339 CAEIDPTAKAIGAVNCIIRR-PDGKLFGCNTDYIGAISAIEEGLQGSQ 385