BP913210
Clone id YMU001_000027_G02
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000027_G02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTCGCGGCCGCGAATGGACTACTAATCGGCTGCAAAAACACATGTAATAGGTTCTTGTC
ACCCTCCACAATTGGAGGCATGTGACGCATCAACTGATCGAAGGTATCCAACACATCACT
ATCACGAACTGTAACTGGAGGTCGAAAGTGCTCTGGCTAGTAATGCATCAGGTCTACTTT
ATAGTTTTTACTCAAGCGCTCAGAGAAGCGCACAAAAGGGCCAAGCTCATCAGCACCCCT
AGCAAACATAGCTCGTTCCAGCTTGTATAACTCCAACCCACCTCTCACACAAAAGTGTAA
CATGCAAAAAAAGGCAAACCTAGACTGACAACCACGGCTATGCTGAATACTGAAGTCGAT
GTCGCGCAAGATCTCTTGTTCCAATGTGACGCCAAGAACTGATGATTTCTTTCGCTCTTT
GCATACTCCACGAGCTACCGATCTTCGCATCGCTGAAATCACTGCATTCTGGGTCGATTT
GAAAATTGGATTCTTTACTATATCAAAGGGAACTT
■■Homology search results ■■ -
sp_hit_id O59490
Definition sp|O59490|XERCL_PYRHO Probable tyrosine recombinase xerC-like OS=Pyrococcus horikoshii
Align length 62
Score (bit) 30.4
E-value 4.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913210|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_G02.
(499 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O59490|XERCL_PYRHO Probable tyrosine recombinase xerC-like OS... 30 4.7
sp|Q5FVW6|SKAP2_XENTR Src kinase-associated phosphoprotein 2 OS=... 30 4.8
sp|Q920G0|SKAP2_RAT Src kinase-associated phosphoprotein 2 OS=Ra... 30 4.8
sp|Q5RDS2|SKAP2_PONAB Src kinase-associated phosphoprotein 2 OS=... 30 4.8
sp|Q3UND0|SKAP2_MOUSE Src kinase-associated phosphoprotein 2 OS=... 30 4.8
sp|O75563|SKAP2_HUMAN Src kinase-associated phosphoprotein 2 OS=... 30 4.8
sp|Q32LP7|SKAP2_BOVIN Src kinase-associated phosphoprotein 2 OS=... 30 4.8
sp|Q5XGP7|SKA2A_XENLA Src kinase-associated phosphoprotein 2-A O... 30 4.8
sp|Q6PG29|SKAP2_DANRE Src kinase-associated phosphoprotein 2 OS=... 30 6.3
sp|Q5U597|SKA2B_XENLA Src kinase-associated phosphoprotein 2-B O... 30 6.3
sp|Q5JHA3|XERCL_PYRKO Probable tyrosine recombinase xerC-like OS... 30 8.0
sp|Q9V1P5|XERCL_PYRAB Probable tyrosine recombinase xerC-like OS... 30 8.0

>sp|O59490|XERCL_PYRHO Probable tyrosine recombinase xerC-like
OS=Pyrococcus horikoshii GN=PH1826 PE=3 SV=1
Length = 285

Score = 30.4 bits (67), Expect = 4.7
Identities = 24/62 (38%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
Frame = +3

Query: 42 VTLHNWRH--VTHQLIEGIQHITITNCNWRSKVLWLVMHQVYFIVFTQALREAHKRAKLI 215
VT H RH TH L G+ I + L Q+Y V T+ LREA ++AKLI
Sbjct: 223 VTPHQLRHSFATHMLERGVDIRIIQELLGHAN---LSTTQIYTKVTTKHLREAIEKAKLI 279

Query: 216 ST 221
T
Sbjct: 280 ET 281


>sp|Q5FVW6|SKAP2_XENTR Src kinase-associated phosphoprotein 2
OS=Xenopus tropicalis GN=skap2 PE=2 SV=2
Length = 328

Score = 30.4 bits (67), Expect = 4.8
Identities = 11/25 (44%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H F AS W KR C + S+F
Sbjct: 112 KRRKDHSFFASEWQKRWCVCTNSMF 136


>sp|Q920G0|SKAP2_RAT Src kinase-associated phosphoprotein 2
OS=Rattus norvegicus GN=Skap2 PE=2 SV=1
Length = 358

Score = 30.4 bits (67), Expect = 4.8
Identities = 12/25 (48%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H FL W KR CA S +VF
Sbjct: 125 KRRKDHSFLGFEWQKRWCALSKTVF 149


>sp|Q5RDS2|SKAP2_PONAB Src kinase-associated phosphoprotein 2
OS=Pongo abelii GN=SKAP2 PE=2 SV=2
Length = 359

Score = 30.4 bits (67), Expect = 4.8
Identities = 12/25 (48%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H FL W KR CA S +VF
Sbjct: 125 KRRKDHSFLGFEWQKRWCALSKTVF 149


>sp|Q3UND0|SKAP2_MOUSE Src kinase-associated phosphoprotein 2 OS=Mus
musculus GN=Skap2 PE=1 SV=2
Length = 358

Score = 30.4 bits (67), Expect = 4.8
Identities = 12/25 (48%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H FL W KR CA S +VF
Sbjct: 125 KRRKDHSFLGFEWQKRWCALSKTVF 149


>sp|O75563|SKAP2_HUMAN Src kinase-associated phosphoprotein 2
OS=Homo sapiens GN=SKAP2 PE=1 SV=1
Length = 359

Score = 30.4 bits (67), Expect = 4.8
Identities = 12/25 (48%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H FL W KR CA S +VF
Sbjct: 125 KRRKDHSFLGFEWQKRWCALSKTVF 149


>sp|Q32LP7|SKAP2_BOVIN Src kinase-associated phosphoprotein 2 OS=Bos
taurus GN=SKAP2 PE=2 SV=1
Length = 358

Score = 30.4 bits (67), Expect = 4.8
Identities = 12/25 (48%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H FL W KR CA S +VF
Sbjct: 125 KRRKDHSFLGFEWQKRWCALSKTVF 149


>sp|Q5XGP7|SKA2A_XENLA Src kinase-associated phosphoprotein 2-A
OS=Xenopus laevis GN=skap2-A PE=2 SV=1
Length = 330

Score = 30.4 bits (67), Expect = 4.8
Identities = 11/25 (44%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H F AS W KR C + S+F
Sbjct: 114 KRRKDHSFFASEWQKRWCVLTNSMF 138


>sp|Q6PG29|SKAP2_DANRE Src kinase-associated phosphoprotein 2
OS=Danio rerio GN=skap2 PE=2 SV=1
Length = 341

Score = 30.0 bits (66), Expect = 6.3
Identities = 10/25 (40%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H F + W KR CA + S+F
Sbjct: 114 KRRKDHSFFGNEWQKRWCALNNSIF 138


>sp|Q5U597|SKA2B_XENLA Src kinase-associated phosphoprotein 2-B
OS=Xenopus laevis GN=skap2-B PE=2 SV=1
Length = 330

Score = 30.0 bits (66), Expect = 6.3
Identities = 11/25 (44%), Positives = 15/25 (60%)
Frame = -1

Query: 403 KSERNHQFLASHWNKRSCATSTSVF 329
K ++H F AS W KR C + S+F
Sbjct: 114 KRRKDHSFFASEWQKRWCVFTNSLF 138


tr_hit_id A9TJK4
Definition tr|A9TJK4|A9TJK4_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 165
Score (bit) 84.7
E-value 2.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913210|Adiantum capillus-veneris mRNA, clone:
YMU001_000027_G02.
(499 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TJK4|A9TJK4_PHYPA Predicted protein OS=Physcomitrella paten... 85 2e-15
tr|A9T3H6|A9T3H6_PHYPA Predicted protein OS=Physcomitrella paten... 75 2e-12
tr|A9SAM0|A9SAM0_PHYPA Predicted protein OS=Physcomitrella paten... 75 2e-12
tr|A9TVS0|A9TVS0_PHYPA Predicted protein OS=Physcomitrella paten... 63 7e-09
tr|A8NG98|A8NG98_BRUMA Putative uncharacterized protein (Fragmen... 35 2.0
tr|B6PF88|B6PF88_BRAFL Putative uncharacterized protein OS=Branc... 34 3.4
tr|B1QV87|B1QV87_CLOBU Putative uncharacterized protein OS=Clost... 33 7.4
tr|A4HH07|A4HH07_LEIBR Endonuclease/exonuclease/phosphatase-like... 33 9.7

>tr|A9TJK4|A9TJK4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_170451 PE=4 SV=1
Length = 894

Score = 84.7 bits (208), Expect = 2e-15
Identities = 53/165 (32%), Positives = 83/165 (50%)
Frame = -3

Query: 497 VPFDIVKNPIFKSTQNAVISAMRRSVARGVCKERKKSSVLGVTLEQEILRDIDFSIQHSR 318
VPF+I+ + FK + AV + + G+ K RK+ VL + E +L + ++
Sbjct: 318 VPFNIMSDVRFKKARQAVSDNVASAGRLGLGKRRKRIDVLTLHDEAAMLALSTYKATTAK 377

Query: 317 GCQSRFAFFCMLHFCVRGGLELYKLERAMFARGADELGPFVRFSERLSKNYKVDLMHY*P 138
GC RFA+FC +F +RG EL++L F+ G D G F+R+ +R K++ D P
Sbjct: 378 GCSMRFAYFCTRNFFIRGPAELHELTDMDFSLGKDHHGEFLRYEKR-PKSWSSDSPQSQP 436

Query: 137 EHFRPPVTVRDSDVLDTFDQLMRHMPPIVEGDKNLLHVFLQPISS 3
E F PVT DV+ T+ ++ H P E + FL I +
Sbjct: 437 EKFSRPVTCYIEDVVSTYKIMVEHKPKWAEDEPPPRPFFLTDIKN 481


>tr|A9T3H6|A9T3H6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167861 PE=4 SV=1
Length = 799

Score = 74.7 bits (182), Expect = 2e-12
Identities = 52/163 (31%), Positives = 79/163 (48%)
Frame = -3

Query: 497 VPFDIVKNPIFKSTQNAVISAMRRSVARGVCKERKKSSVLGVTLEQEILRDIDFSIQHSR 318
VPF I ++P F + AV A+ +S A KE V E E+L FS H
Sbjct: 582 VPFSIYRDPRFLKVKWAVEDAVAKSAAIESAKEVIALEVHPPMNEGEMLNQCKFSNTHPE 641

Query: 317 GCQSRFAFFCMLHFCVRGGLELYKLERAMFARGADELGPFVRFSERLSKNYKVDLMHY*P 138
GC RFA+FC+ F V+G EL +L F DE G +R++ + N+K ++ + P
Sbjct: 642 GCSRRFAYFCLRDFYVKGRSELRELSDVDFELFTDEHGECLRYTRGMGANWKHNIDNQ-P 700

Query: 137 EHFRPPVTVRDSDVLDTFDQLMRHMPPIVEGDKNLLHVFLQPI 9
H + SDVL+ + LM H P ++ + +FL+ +
Sbjct: 701 RH---SIRCYISDVLEAYHTLMAHRPVWLDTEPPPHPIFLKSL 740


>tr|A9SAM0|A9SAM0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_163835 PE=4 SV=1
Length = 704

Score = 74.7 bits (182), Expect = 2e-12
Identities = 49/146 (33%), Positives = 71/146 (48%)
Frame = -3

Query: 497 VPFDIVKNPIFKSTQNAVISAMRRSVARGVCKERKKSSVLGVTLEQEILRDIDFSIQHSR 318
VPF I ++P F + AV A+ +S A KE V E +L FS H
Sbjct: 487 VPFSIYRDPRFLRVKLAVEEAVAKSAAIESAKEVMTLEVHPPMNEIGMLSQCKFSNTHPE 546

Query: 317 GCQSRFAFFCMLHFCVRGGLELYKLERAMFARGADELGPFVRFSERLSKNYKVDLMHY*P 138
GC RF +FC+ FCV+G EL +L F DE G +R++ + N K+++ + P
Sbjct: 547 GCNRRFVYFCLRDFCVKGRSELRELSDVDFELFTDEHGECLRYTRGMGANLKLNIDNQ-P 605

Query: 137 EHFRPPVTVRDSDVLDTFDQLMRHMP 60
H + +DVL+T+ LM H P
Sbjct: 606 RH---SIRCYITDVLETYHVLMAHRP 628


>tr|A9TVS0|A9TVS0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_97924 PE=4 SV=1
Length = 606

Score = 63.2 bits (152), Expect = 7e-09
Identities = 45/149 (30%), Positives = 70/149 (46%)
Frame = -3

Query: 494 PFDIVKNPIFKSTQNAVISAMRRSVARGVCKERKKSSVLGVTLEQEILRDIDFSIQHSRG 315
P +I+ + FK AV + + G+ K RK S+L + E +L + ++G
Sbjct: 193 PLNIMSDVRFKKAGQAVSDNVASAGRLGLGKRRKCISILTLLDEAAMLALSTYKCTSAKG 252

Query: 314 CQSRFAFFCMLHFCVRGGLELYKLERAMFARGADELGPFVRFSERLSKNYKVDLMHY*PE 135
C RFA+FC F +RG EL++L F G D+ G + E+ K++ D PE
Sbjct: 253 CSMRFAYFCTQKFFIRGTAELHELTDMDFTLGKDQHGDY----EKRLKSWSSDCPLSHPE 308

Query: 134 HFRPPVTVRDSDVLDTFDQLMRHMPPIVE 48
F P+T DV T +++H P E
Sbjct: 309 KFSLPMTCYIEDV-STHKIMIQHKPKWAE 336


>tr|A8NG98|A8NG98_BRUMA Putative uncharacterized protein (Fragment)
OS=Brugia malayi GN=Bm1_01875 PE=4 SV=1
Length = 1090

Score = 35.0 bits (79), Expect = 2.0
Identities = 34/164 (20%), Positives = 66/164 (40%), Gaps = 17/164 (10%)
Frame = -3

Query: 470 IFKSTQNAVISAMRRSVARGV---CKERKKSSVL--GVTLEQEILRDIDFSIQHSRGCQS 306
IF+S V+ M+ A + C + ++ S L G L+ + + I S GC S
Sbjct: 843 IFQSANETVVIYMQNKFATTIMMSCDDVRQISRLSSGHMLKTKATTEEATIIMLSIGCIS 902

Query: 305 RFA------------FFCMLHFCVRGGLELYKLERAMFARGADELGPFVRFSERLSKNYK 162
++A C ++ C R E ++ R L +R ER+ + +
Sbjct: 903 KYANTLMTEFIVKDAHKCKVNLCSRASRESERISNVSLNRSTKMLATTIRLLERIKRKEQ 962

Query: 161 VDLMHY*PEHFRPPVTVRDSDVLDTFDQLMRHMPPIVEGDKNLL 30
+ + + E+ + ++ + + T Q+ R P V G N++
Sbjct: 963 LTVTEFGDENEHVAILLQRAGI--THGQVQREWPEAVTGRSNII 1004


>tr|B6PF88|B6PF88_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_106251 PE=4 SV=1
Length = 913

Score = 34.3 bits (77), Expect = 3.4
Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 7/143 (4%)
Frame = -3

Query: 467 FKSTQNAVISAMRRSVARGVCKERKKSSVLGVTLEQEILRDIDFSIQHSRGCQSRFAFFC 288
F+ + A+ + M+ A G+ +K++ L E + S S+G +
Sbjct: 605 FEEFRKALDTRMKELTAMGIGVTKKQAEPLTPDDESRLWDSNTISTTTSQGLSYGVFLYN 664

Query: 287 MLHFCVRGGLELYKLERAMFARGADELGPFVRFSERLSKNY-------KVDLMHY*PEHF 129
F +RG E +L + G D G ++ ++ R+SKN +VD+ + +
Sbjct: 665 CKVFGLRGMDEHQRLMLDQYRFGTDAQGRYMEYTGRVSKNVQGGLQQRQVDVKRI--KQY 722

Query: 128 RPPVTVRDSDVLDTFDQLMRHMP 60
P R V++ F+Q RH+P
Sbjct: 723 ASPTNPR--CVVNLFEQYTRHLP 743


>tr|B1QV87|B1QV87_CLOBU Putative uncharacterized protein
OS=Clostridium butyricum 5521 GN=CBY_1929 PE=4 SV=1
Length = 204

Score = 33.1 bits (74), Expect = 7.4
Identities = 12/33 (36%), Positives = 21/33 (63%)
Frame = -1

Query: 136 STFDLQLQFVIVMCWIPSIS*CVTCLQLWRVTR 38
STF L +F++ +C + ++ CV CL +W + R
Sbjct: 154 STFGLLNEFILFLCLLNAMGSCVDCLNIWIILR 186


>tr|A4HH07|A4HH07_LEIBR
Endonuclease/exonuclease/phosphatase-likeprotein
OS=Leishmania braziliensis GN=LbrM28_V2.3260 PE=4 SV=1
Length = 1100

Score = 32.7 bits (73), Expect = 9.7
Identities = 21/88 (23%), Positives = 41/88 (46%)
Frame = +1

Query: 46 PSTIGGM*RIN*SKVSNTSLSRTVTGGRKCSG**CIRSTL*FLLKRSEKRTKGPSSSAPL 225
P T+ G+ + K S+ S++ T+TG CSG S +R +++
Sbjct: 34 PPTLFGIPCSSERKSSSASITATLTGATTCSG------------DASARRGMASGATSSS 81

Query: 226 ANIARSSLYNSNPPLTQKCNMQKKANLD 309
++ R + + PPLT+ C+ ++ + D
Sbjct: 82 TDVDRGNGPHHLPPLTEPCSSRRSSRCD 109