BP913240
Clone id YMU001_000028_A11
Library
Length 519
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_A11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATGAAAGGAAACAGTGAAGATGAAGAAGCGGGAGAGCCGCAGTTTAAGATAATTGATGT
GCATATGTCGGGTTTGAAGACGTCTCAAGAGGGGAAAAAGATAGGCTGGGGAAATCAGAA
GCAGCAACAATCTGGTTCTAGGTGGCTTATTGCCAATGGGATGGCAAAGAATGCTAAAGT
GAACAAACCCATGCTGGGCTCCAAGCCAGCAGCGATGTCTTCAGCGTCATCCTCAAAAGC
TAATGCCAACAAGGGTGAGTCTCTGTGGAGCATATCCTCGAGGGCACTTGGCACTGGACT
GAGATGGAGGGACAAGCTCAAGCTGAATGCCTCTGCGAGATAAACGATCTGTAAGTTAAG
ACTTTGTATTTTATAAGTATACAATTTCCTGAGCTCATAACATTCATGAGGACCTCACTG
CTGCAGCTTGTAACATCACATTAGTCCTGATTGTCAGTGAGCTTGTACAACTTTGTAAAT
CTAGGTTAAGCTTTCATATTCTTAATGCCACAGGCTTGA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913240|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_A11.
(519 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A7PE22
Definition tr|A7PE22|A7PE22_VITVI Chromosome chr11 scaffold_13, whole genome shotgun sequence OS=Vitis vinifera
Align length 106
Score (bit) 92.8
E-value 9.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913240|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_A11.
(519 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PE22|A7PE22_VITVI Chromosome chr11 scaffold_13, whole genom... 93 9e-18
tr|A5B9N2|A5B9N2_VITVI Putative uncharacterized protein OS=Vitis... 93 9e-18
tr|A9TG40|A9TG40_PHYPA Predicted protein (Fragment) OS=Physcomit... 91 3e-17
tr|B8A8N6|B8A8N6_ORYSI Putative uncharacterized protein OS=Oryza... 84 5e-15
tr|Q5N8D0|Q5N8D0_ORYSJ Putative uncharacterized protein B1142C05... 81 4e-14
tr|Q0JJV7|Q0JJV7_ORYSJ Os01g0714100 protein (Fragment) OS=Oryza ... 81 4e-14
tr|A2ZX67|A2ZX67_ORYSJ Putative uncharacterized protein OS=Oryza... 81 4e-14
tr|Q84W59|Q84W59_ARATH Putative uncharacterized protein At5g2061... 70 6e-11
tr|Q0WLI8|Q0WLI8_ARATH Putative uncharacterized protein At5g2061... 68 2e-10
tr|A9TT30|A9TT30_PHYPA Predicted protein OS=Physcomitrella paten... 67 4e-10
tr|A5AQ49|A5AQ49_VITVI Putative uncharacterized protein OS=Vitis... 67 7e-10
tr|A7P4P3|A7P4P3_VITVI Chromosome chr4 scaffold_6, whole genome ... 65 2e-09
tr|A9RVN4|A9RVN4_PHYPA Predicted protein OS=Physcomitrella paten... 59 2e-07
tr|B6SSY2|B6SSY2_MAIZE Putative uncharacterized protein OS=Zea m... 48 3e-04
tr|Q0IZR7|Q0IZR7_ORYSJ Os09g0553900 protein OS=Oryza sativa subs... 47 7e-04
tr|A3C1C0|A3C1C0_ORYSJ Putative uncharacterized protein OS=Oryza... 47 7e-04
tr|A2Z3W4|A2Z3W4_ORYSI Putative uncharacterized protein OS=Oryza... 47 7e-04
tr|A7QPF7|A7QPF7_VITVI Chromosome chr18 scaffold_137, whole geno... 46 0.001
tr|Q7Y219|Q7Y219_ARATH Putative uncharacterized protein At5g2616... 42 0.024
tr|Q5DKY0|Q5DKY0_9HEMI Cytochrome b (Fragment) OS=Australicoccus... 36 1.3
tr|B1KGR8|B1KGR8_SHEWM Putative uncharacterized protein OS=Shewa... 33 6.5
tr|B6KDX7|B6KDX7_TOXGO Putative uncharacterized protein OS=Toxop... 33 6.5

>tr|A7PE22|A7PE22_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016501001
PE=4 SV=1
Length = 839

Score = 92.8 bits (229), Expect = 9e-18
Identities = 53/106 (50%), Positives = 63/106 (59%)
Frame = +2

Query: 23 EEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQQSGSRWLIANGMAKNAKVNKPMLGS 202
EE PQFKI +VH++GLKT + GKK WG QQQSGSRWL+ANGM KN K P + S
Sbjct: 724 EEEAIPQFKITEVHVAGLKT-EPGKKKLWGTSTQQQSGSRWLLANGMGKNNK--HPFMKS 780

Query: 203 KPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRWRDKLKLNASAR 340
K GE+LWSISSR GTG +W++ LN R
Sbjct: 781 K-AVSKSTSPATTTVQPGETLWSISSRVHGTGAKWKELAALNPHIR 825


>tr|A5B9N2|A5B9N2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009913 PE=4 SV=1
Length = 1134

Score = 92.8 bits (229), Expect = 9e-18
Identities = 53/106 (50%), Positives = 63/106 (59%)
Frame = +2

Query: 23 EEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQQSGSRWLIANGMAKNAKVNKPMLGS 202
EE PQFKI +VH++GLKT + GKK WG QQQSGSRWL+ANGM KN K P + S
Sbjct: 1019 EEEAIPQFKITEVHVAGLKT-EPGKKKLWGTSTQQQSGSRWLLANGMGKNNK--HPFMKS 1075

Query: 203 KPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRWRDKLKLNASAR 340
K GE+LWSISSR GTG +W++ LN R
Sbjct: 1076 K-AVSKSTSPATTTVQPGETLWSISSRVHGTGAKWKELAALNPHIR 1120


>tr|A9TG40|A9TG40_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_3549 PE=4 SV=1
Length = 463

Score = 90.9 bits (224), Expect = 3e-17
Identities = 48/114 (42%), Positives = 69/114 (60%), Gaps = 4/114 (3%)
Frame = +2

Query: 11 NSEDEEAGEPQFKIIDVHMSGLKT---SQEGKKIG-WGNQKQQQSGSRWLIANGMAKNAK 178
+ E+E+ +P+F I+DV +SGLKT S +++ WGNQKQ Q+G+RWL+A+GM K+ K
Sbjct: 345 DQEEEDLKKPRFMIVDVTVSGLKTDKSSNSNRRVELWGNQKQLQAGTRWLVAHGMQKSTK 404

Query: 179 VNKPMLGSKPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRWRDKLKLNASAR 340
+ + G P GE+LWSIS+R GTG +WRD K+N R
Sbjct: 405 SHPALKGKTP--SQPKSAPQVKVQRGETLWSISARVHGTGAKWRDLAKMNPHIR 456


>tr|B8A8N6|B8A8N6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03496 PE=4 SV=1
Length = 395

Score = 83.6 bits (205), Expect = 5e-15
Identities = 46/97 (47%), Positives = 57/97 (58%)
Frame = +2

Query: 17 EDEEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQQSGSRWLIANGMAKNAKVNKPML 196
E+EE PQFK+ +VH++G K+ E K WGNQ QQQSGSRWL+A GM K K P++
Sbjct: 284 EEEEDSVPQFKVAEVHVAGFKSEPEKTK-SWGNQTQQQSGSRWLLAAGMGKGNK--HPLM 340

Query: 197 GSKPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRW 307
SK G++LWSISSR G G RW
Sbjct: 341 KSK---AIAKPTKEAAGQSGDTLWSISSRVHGAGTRW 374


>tr|Q5N8D0|Q5N8D0_ORYSJ Putative uncharacterized protein B1142C05.36
(Putative uncharacterized protein B1131B07.1) OS=Oryza
sativa subsp. japonica GN=B1142C05.36 PE=4 SV=1
Length = 394

Score = 80.9 bits (198), Expect = 4e-14
Identities = 45/97 (46%), Positives = 56/97 (57%)
Frame = +2

Query: 17 EDEEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQQSGSRWLIANGMAKNAKVNKPML 196
E+EE PQFK+ +VH++G K+ E K WGNQ QQQSGSRWL+A GM K K P++
Sbjct: 283 EEEEDSVPQFKVAEVHVAGFKSEPEKTK-SWGNQTQQQSGSRWLLAAGMGKGNK--HPLM 339

Query: 197 GSKPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRW 307
SK ++LWSISSR G G RW
Sbjct: 340 KSKAIAKPTKEAAGQSE---DTLWSISSRVHGAGTRW 373


>tr|Q0JJV7|Q0JJV7_ORYSJ Os01g0714100 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os01g0714100 PE=4 SV=1
Length = 401

Score = 80.9 bits (198), Expect = 4e-14
Identities = 45/97 (46%), Positives = 56/97 (57%)
Frame = +2

Query: 17 EDEEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQQSGSRWLIANGMAKNAKVNKPML 196
E+EE PQFK+ +VH++G K+ E K WGNQ QQQSGSRWL+A GM K K P++
Sbjct: 290 EEEEDSVPQFKVAEVHVAGFKSEPEKTK-SWGNQTQQQSGSRWLLAAGMGKGNK--HPLM 346

Query: 197 GSKPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRW 307
SK ++LWSISSR G G RW
Sbjct: 347 KSKAIAKPTKEAAGQSE---DTLWSISSRVHGAGTRW 380


>tr|A2ZX67|A2ZX67_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003139 PE=4 SV=1
Length = 1153

Score = 80.9 bits (198), Expect = 4e-14
Identities = 45/97 (46%), Positives = 56/97 (57%)
Frame = +2

Query: 17 EDEEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQQSGSRWLIANGMAKNAKVNKPML 196
E+EE PQFK+ +VH++G K+ E K WGNQ QQQSGSRWL+A GM K K P++
Sbjct: 1042 EEEEDSVPQFKVAEVHVAGFKSEPEKTK-SWGNQTQQQSGSRWLLAAGMGKGNK--HPLM 1098

Query: 197 GSKPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRW 307
SK ++LWSISSR G G RW
Sbjct: 1099 KSKAIAKPTKEAAGQSE---DTLWSISSRVHGAGTRW 1132


>tr|Q84W59|Q84W59_ARATH Putative uncharacterized protein At5g20610
(Fragment) OS=Arabidopsis thaliana GN=At5g20610 PE=2
SV=1
Length = 464

Score = 70.1 bits (170), Expect = 6e-11
Identities = 45/109 (41%), Positives = 62/109 (56%), Gaps = 5/109 (4%)
Frame = +2

Query: 23 EEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQ-QSGSRWLIANGMAK---NAKVNKP 190
EE G PQ+KI +VH++G+K+ + K G Q+QQ QSGSRWL+ANGM K + KP
Sbjct: 362 EEQGIPQYKITEVHLTGMKSETDKKPWGITTQQQQVQSGSRWLMANGMGKGNNKLPLMKP 421

Query: 191 MLGS-KPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRWRDKLKLNAS 334
LGS KP G+ LWS+S G+G +W++ K+ S
Sbjct: 422 KLGSAKP---------------GDKLWSVS----GSGSKWKELGKMGKS 451


>tr|Q0WLI8|Q0WLI8_ARATH Putative uncharacterized protein At5g20610
(Fragment) OS=Arabidopsis thaliana GN=At5g20610 PE=2
SV=1
Length = 794

Score = 68.2 bits (165), Expect = 2e-10
Identities = 44/109 (40%), Positives = 62/109 (56%), Gaps = 5/109 (4%)
Frame = +2

Query: 23 EEAGEPQFKIIDVHMSGLKTSQEGKKIGWGNQKQQ-QSGSRWLIANGMAK---NAKVNKP 190
EE G PQ+KI +VH++G+K+ + K G Q+QQ QSGSRWL+A+GM K + KP
Sbjct: 692 EEQGIPQYKITEVHLTGMKSETDKKPWGITTQQQQVQSGSRWLMASGMGKGNNKLPLMKP 751

Query: 191 MLGS-KPXXXXXXXXXXXXXXXGESLWSISSRALGTGLRWRDKLKLNAS 334
LGS KP G+ LWS+S G+G +W++ K+ S
Sbjct: 752 KLGSAKP---------------GDKLWSVS----GSGSKWKELGKMGKS 781


>tr|A9TT30|A9TT30_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_150177 PE=4 SV=1
Length = 503

Score = 67.4 bits (163), Expect = 4e-10
Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 10/66 (15%)
Frame = +2

Query: 11 NSEDEEAGEPQFKIIDVHMSGLKTSQEGK----------KIGWGNQKQQQSGSRWLIANG 160
+ ED + +PQFKI +V +SG+K S E +IGWG KQQQSGSRWL A+G
Sbjct: 355 DDEDSRSRQPQFKIREVTLSGVKASDESASDKKQQTSALQIGWGTPKQQQSGSRWLAASG 414

Query: 161 MAKNAK 178
MAKN+K
Sbjct: 415 MAKNSK 420