BP913253
Clone id YMU001_000028_C01
Library
Length 516
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAATAATGCTTGCTTTCAGCACCGCACTATCGGTGGACATACTTCGACACACAGGGGCCT
TCGTTGCAAGCACGTGCCATACTCAAAGCCTGAAGTGTTGCATGTCATTGGATTACATAG
CAGGAAATTTGCACAATTTAAGAGTAACACTAATCTGTTCTCTGCTGGTCAAGCAAGGTA
ATTGTATATCTGGGGATTGCTTTTGTCCCTCTCCAAGTACTCTCTATCAATCAAACTCTC
TATTCTTTTCTTCAAATCTGCTGGCTTAATGGGGAATTTAAGCTGTTGAAAAAGCTCAGT
TATTAACAGGGTATGGCTAAGAACTTTTCTCGTCTTCATGATTCTCACAATAGCAGCATC
TATCTGATATTGCCTATCCTGAAAAACCCTTTCAGTGGTGCTTGTATTTTCCTCCACAGT
CTCTTTTAGCTGAATTGCATTTACTTTGATTCGAAACAGCGGTGCAACAAAGTCCCCATT
GAAAGAAAAGCTATCATCGTCGTCCACATCTCTACC
■■Homology search results ■■ -
sp_hit_id Q13620
Definition sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens
Align length 96
Score (bit) 159.0
E-value 1.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913253|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C01.
(516 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=3 159 1e-38
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 154 2e-37
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=2 SV=1 152 7e-37
sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=cul... 131 2e-30
sp|Q17392|CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans GN=cul-4... 109 7e-24
sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=cul... 102 1e-21
sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE... 88 3e-17
sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 84 4e-16
sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 84 4e-16
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe GN=cu... 79 1e-14
sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3... 79 1e-14
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe GN=cu... 74 3e-13
sp|Q17390|CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans GN=cul-2... 73 7e-13
sp|Q5RCF3|CUL2_PONAB Cullin-2 OS=Pongo abelii GN=CUL2 PE=2 SV=1 72 2e-12
sp|Q13617|CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2 72 2e-12
sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2 72 2e-12
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 71 3e-12
sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1 71 3e-12
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 71 3e-12
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster... 70 6e-12
sp|Q21346|CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans GN=cul-6... 69 1e-11
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=cul... 67 4e-11
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe GN=cu... 66 9e-11
sp|Q9XZJ3|CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum GN=cul... 64 3e-10
sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1... 64 3e-10
sp|Q54XF7|CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum GN=cul... 57 5e-08
sp|P53202|CUL3_YEAST Cullin-3 OS=Saccharomyces cerevisiae GN=CUL... 53 1e-06
sp|Q5RB36|CUL5_PONAB Cullin-5 OS=Pongo abelii GN=CUL5 PE=2 SV=3 50 8e-06
sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens GN=CUL5 PE=1 SV=4 50 8e-06
sp|Q12018|CDC53_YEAST Cell division control protein 53 OS=Saccha... 49 1e-05

>sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=3
Length = 895

Score = 159 bits (401), Expect = 1e-38
Identities = 76/96 (79%), Positives = 86/96 (89%)
Frame = -1

Query: 459 LFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQL 280
LFRIK+N IQ+KETVEE STTERVFQDRQYQIDAAIVRIMK RK LSH LL++E++ QL
Sbjct: 800 LFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQL 859

Query: 279 KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
KFP+KPADLKKRIESLIDR+Y+ERDK NP YNY+A
Sbjct: 860 KFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA 895


>sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3
Length = 759

Score = 154 bits (390), Expect = 2e-37
Identities = 74/96 (77%), Positives = 84/96 (87%)
Frame = -1

Query: 459 LFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQL 280
LFRIK+N IQ+KETVEE STTERVFQDRQYQIDAAIVRIMK RK L H LL++EL+ QL
Sbjct: 664 LFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQL 723

Query: 279 KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
KFP+KP DLKKRIESLIDR+Y+ERDK NP Y+Y+A
Sbjct: 724 KFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 759


>sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=2 SV=1
Length = 759

Score = 152 bits (385), Expect = 7e-37
Identities = 73/96 (76%), Positives = 84/96 (87%)
Frame = -1

Query: 459 LFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQL 280
LFRIK+N IQ+KETVEE STTERVFQDRQYQIDAAIVRIMK RK L H LL++EL+ QL
Sbjct: 664 LFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQL 723

Query: 279 KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
KFP+KP DLKKRIESLIDR+Y+ERDK +P Y+Y+A
Sbjct: 724 KFPVKPGDLKKRIESLIDRDYMERDKDSPNQYHYVA 759


>sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=culD
PE=3 SV=1
Length = 802

Score = 131 bits (329), Expect = 2e-30
Identities = 65/96 (67%), Positives = 76/96 (79%)
Frame = -1

Query: 459 LFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQL 280
LF+IKVN+IQ++ETVEEN T E + DRQYQ+DAAIVRIMKTRK L+H LLI+EL L
Sbjct: 707 LFKIKVNSIQIQETVEENQKTNENIISDRQYQVDAAIVRIMKTRKTLAHNLLISELVSLL 766

Query: 279 KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
KF KP DLKKRIE LI++EYL RD N IYNY+A
Sbjct: 767 KFQPKPVDLKKRIEILIEKEYLCRDPENAMIYNYMA 802


>sp|Q17392|CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans GN=cul-4 PE=1
SV=3
Length = 840

Score = 109 bits (273), Expect = 7e-24
Identities = 51/94 (54%), Positives = 67/94 (71%)
Frame = -1

Query: 453 RIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKF 274
R+++ + +K VEE E V DRQY+IDAA+VRIMK RK L+H L+TEL QQL+F
Sbjct: 747 RVRIAQVNIKTAVEETKEVKEEVNSDRQYKIDAAVVRIMKARKQLNHQTLMTELLQQLRF 806

Query: 273 PIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
P+ AD+KKR+ESLI+REY+ RD YNY+A
Sbjct: 807 PVSTADIKKRLESLIEREYISRDPEEASSYNYVA 840


>sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=culC
PE=3 SV=1
Length = 769

Score = 102 bits (254), Expect = 1e-21
Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
Frame = -1

Query: 459 LFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQL 280
LFR+KV A+ KET E T ++V +DR++QI+A+IVRIMK RK L H+ L++E+ +QL
Sbjct: 672 LFRVKVMAVVQKETPVEEKETRDKVDEDRKHQIEASIVRIMKARKTLEHSNLVSEVIKQL 731

Query: 279 --KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
+F P +KKRIESLI+REYLER K + +IYNY+A
Sbjct: 732 QSRFVPNPVIVKKRIESLIEREYLERSKQDRKIYNYMA 769


>sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1
SV=1
Length = 738

Score = 87.8 bits (216), Expect = 3e-17
Identities = 46/84 (54%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
Frame = -1

Query: 417 VEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKP--ADLKKR 244
V+E E V +DR+Y IDAAIVRIMK+RKVL H L++E +QL KP +KKR
Sbjct: 655 VDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKR 714

Query: 243 IESLIDREYLERDKSNPQIYNYLA 172
+E LI R+YLERDK NP ++ YLA
Sbjct: 715 MEDLITRDYLERDKENPNMFRYLA 738


>sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1
Length = 768

Score = 84.0 bits (206), Expect = 4e-16
Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
Frame = -1

Query: 459 LFRIKVNAIQLK--ETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
L R+K+ + K E+ E T ++V DR+++I+AAIVRIMK+RK + H +L+ E+ Q
Sbjct: 669 LHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQ 728

Query: 285 QLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLK F P +KKRIE LI+REYL R + ++Y Y+A
Sbjct: 729 QLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768


>sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2
Length = 768

Score = 84.0 bits (206), Expect = 4e-16
Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
Frame = -1

Query: 459 LFRIKVNAIQLK--ETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
L R+K+ + K E+ E T ++V DR+++I+AAIVRIMK+RK + H +L+ E+ Q
Sbjct: 669 LHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQ 728

Query: 285 QLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLK F P +KKRIE LI+REYL R + ++Y Y+A
Sbjct: 729 QLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768


>sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe GN=cul3
PE=1 SV=2
Length = 785

Score = 79.3 bits (194), Expect = 1e-14
Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
Frame = -1

Query: 459 LFRIKVNAIQLK--ETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
L RIK++ + E E T E+V + R++Q DA IVR+MK RKV H L+ E+ +
Sbjct: 686 LARIKISTVAQTRVEDDSERKRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLMAEVTR 745

Query: 285 QL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QL +F P +K+RIE+LI+REYL+R N +IY YLA
Sbjct: 746 QLNPRFHPSPMMIKRRIEALIEREYLQRQADNGRIYEYLA 785


tr_hit_id A9TCM3
Definition tr|A9TCM3|A9TCM3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 98
Score (bit) 190.0
E-value 3.0e-47
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913253|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C01.
(516 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TCM3|A9TCM3_PHYPA Predicted protein OS=Physcomitrella paten... 190 3e-47
tr|A9SEG5|A9SEG5_PHYPA Predicted protein OS=Physcomitrella paten... 189 7e-47
tr|Q9FGP0|Q9FGP0_ARATH Cullin OS=Arabidopsis thaliana PE=3 SV=1 188 2e-46
tr|Q8RWT9|Q8RWT9_ARATH Putative cullin OS=Arabidopsis thaliana G... 188 2e-46
tr|Q8LGH4|Q8LGH4_ARATH Cullin OS=Arabidopsis thaliana PE=1 SV=1 188 2e-46
tr|Q84LL5|Q84LL5_ARATH Cullin 4 OS=Arabidopsis thaliana GN=cul4 ... 188 2e-46
tr|A9LK40|A9LK40_SOLLC Cullin 4 OS=Solanum lycopersicum GN=CUL4 ... 188 2e-46
tr|A7Q145|A7Q145_VITVI Chromosome chr10 scaffold_43, whole genom... 188 2e-46
tr|A5AQK8|A5AQK8_VITVI Putative uncharacterized protein OS=Vitis... 188 2e-46
tr|B4FCU9|B4FCU9_MAIZE Putative uncharacterized protein OS=Zea m... 186 8e-46
tr|Q6F3B6|Q6F3B6_ORYSJ Putative cullin protein (Putative unchara... 184 2e-45
tr|Q10CD7|Q10CD7_ORYSJ Cullin-4B, putative, expressed OS=Oryza s... 184 2e-45
tr|Q0DMY2|Q0DMY2_ORYSJ Os03g0786800 protein (Fragment) OS=Oryza ... 184 2e-45
tr|B8AKX8|B8AKX8_ORYSI Putative uncharacterized protein OS=Oryza... 184 2e-45
tr|O82002|O82002_SOLLC Putative cullin protein OS=Solanum lycope... 177 2e-43
tr|Q93YY3|Q93YY3_OLEEU Putative cullin protein (Fragment) OS=Ole... 176 6e-43
tr|Q1W691|Q1W691_ORYSA Cullin (Fragment) OS=Oryza sativa PE=2 SV=1 169 1e-40
tr|Q9CZM5|Q9CZM5_MOUSE Putative uncharacterized protein (Fragmen... 159 1e-37
tr|Q99KS9|Q99KS9_MOUSE Cul4b protein OS=Mus musculus GN=Cul4b PE... 159 1e-37
tr|Q91YZ7|Q91YZ7_MOUSE Cul4b protein OS=Mus musculus GN=Cul4b PE... 159 1e-37
tr|Q3TU30|Q3TU30_MOUSE Putative uncharacterized protein (Fragmen... 159 1e-37
tr|Q3TP81|Q3TP81_MOUSE Putative uncharacterized protein (Fragmen... 159 1e-37
tr|A2A432|A2A432_MOUSE Cullin 4B OS=Mus musculus GN=Cul4b PE=3 SV=1 159 1e-37
tr|Q1WF15|Q1WF15_FELCA CUL4BX OS=Felis silvestris catus PE=2 SV=1 159 1e-37
tr|B7Z5K8|B7Z5K8_HUMAN cDNA FLJ53167, highly similar to Cullin-4... 159 1e-37
tr|B3KVX4|B3KVX4_HUMAN cDNA FLJ41694 fis, clone HCHON2001217, hi... 159 1e-37
tr|B1APK5|B1APK5_HUMAN Cullin 4B OS=Homo sapiens GN=CUL4B PE=2 SV=1 159 1e-37
tr|A6NE76|A6NE76_HUMAN Cullin 4B, isoform CRA_e OS=Homo sapiens ... 159 1e-37
tr|B3DLE7|B3DLE7_XENTR Putative uncharacterized protein (Fragmen... 157 3e-37
tr|B2GU90|B2GU90_XENTR Cul4b protein OS=Xenopus tropicalis GN=cu... 157 3e-37

>tr|A9TCM3|A9TCM3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_193769 PE=3 SV=1
Length = 768

Score = 190 bits (483), Expect = 3e-47
Identities = 97/98 (98%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 671 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 730

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLERDK+NPQIYNYLA
Sbjct: 731 QLKFPIKPADLKKRIESLIDREYLERDKANPQIYNYLA 768


>tr|A9SEG5|A9SEG5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_128517 PE=3 SV=1
Length = 745

Score = 189 bits (480), Expect = 7e-47
Identities = 96/98 (97%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APLFRIKVNAIQLKETVEENT+TTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 648 APLFRIKVNAIQLKETVEENTTTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 707

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLERDK+NPQIYNYLA
Sbjct: 708 QLKFPIKPADLKKRIESLIDREYLERDKANPQIYNYLA 745


>tr|Q9FGP0|Q9FGP0_ARATH Cullin OS=Arabidopsis thaliana PE=3 SV=1
Length = 617

Score = 188 bits (477), Expect = 2e-46
Identities = 95/98 (96%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 520 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 579

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLER+KSNPQIYNYLA
Sbjct: 580 QLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA 617


>tr|Q8RWT9|Q8RWT9_ARATH Putative cullin OS=Arabidopsis thaliana
GN=At5g46210 PE=2 SV=1
Length = 792

Score = 188 bits (477), Expect = 2e-46
Identities = 95/98 (96%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 695 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 754

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLER+KSNPQIYNYLA
Sbjct: 755 QLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA 792


>tr|Q8LGH4|Q8LGH4_ARATH Cullin OS=Arabidopsis thaliana PE=1 SV=1
Length = 792

Score = 188 bits (477), Expect = 2e-46
Identities = 95/98 (96%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 695 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 754

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLER+KSNPQIYNYLA
Sbjct: 755 QLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA 792


>tr|Q84LL5|Q84LL5_ARATH Cullin 4 OS=Arabidopsis thaliana GN=cul4
PE=2 SV=1
Length = 742

Score = 188 bits (477), Expect = 2e-46
Identities = 95/98 (96%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 645 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 704

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLER+KSNPQIYNYLA
Sbjct: 705 QLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA 742


>tr|A9LK40|A9LK40_SOLLC Cullin 4 OS=Solanum lycopersicum GN=CUL4
PE=2 SV=1
Length = 785

Score = 188 bits (477), Expect = 2e-46
Identities = 94/98 (95%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 688 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQ 747

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLERDK+NPQIYNYLA
Sbjct: 748 QLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 785


>tr|A7Q145|A7Q145_VITVI Chromosome chr10 scaffold_43, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028307001
PE=3 SV=1
Length = 802

Score = 188 bits (477), Expect = 2e-46
Identities = 94/98 (95%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 705 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQ 764

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLERDK+NPQIYNYLA
Sbjct: 765 QLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 802


>tr|A5AQK8|A5AQK8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_010491 PE=3 SV=1
Length = 806

Score = 188 bits (477), Expect = 2e-46
Identities = 94/98 (95%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLITELFQ
Sbjct: 709 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQ 768

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFPIKPADLKKRIESLIDREYLERDK+NPQIYNYLA
Sbjct: 769 QLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 806


>tr|B4FCU9|B4FCU9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 160

Score = 186 bits (471), Expect = 8e-46
Identities = 91/98 (92%), Positives = 98/98 (100%)
Frame = -1

Query: 465 APLFRIKVNAIQLKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQ 286
APL+RIKVNAIQ+KETVEENTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLITEL+Q
Sbjct: 63 APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELYQ 122

Query: 285 QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 172
QLKFP+KPAD+KKRIESLIDREYLERD+SNPQIYNYLA
Sbjct: 123 QLKFPVKPADIKKRIESLIDREYLERDRSNPQIYNYLA 160