BP913254
Clone id YMU001_000028_C02
Library
Length 614
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGCTAGGTAGTTATTTGCATATGAATCACCTCTTATTAATGATGCTACATTTATCAATA
AGTGACATGCGTAATTAGAAGTCATGGGGATTTATTTGGCATTTGCTTGACCCCACCTTG
CCAAGCTATAAAGGAGGCCCCTTGGGTCAGGGGTAGTCAGTACCCTGCAAACCCAACACC
CTAGTGTTTTCTCCCACAACATCCTGGCCTTTTTACCACCAAGCACCAAGCAACTGCAGA
TCAGCCATTTGCATTTTCAGCCAGCCACAATCATCAGCATTTTTCAGCAGTATCACCCTA
CAGTAGCAGATCGGTCTCGCAGTACCAAGTCAGACCCAGCGCTAGCAAATTCAGCCCTTG
GATCCATCATCCTCACCAGCGTATTCAGATTTCAGCCCATCATCAGCACCCTCGACGTTG
GCATTAGCAGGGCAGCCCATAGCCTCATCAAGTTGCAGATTCAGACCCAATCCACGAGCA
TTTGCGTTTTCAGTCAGTCTTTAGCCTCTCAGATGAAAGCATTTGCCGCAAGGTCTCATC
AACATCTGAGCATCTAGATCCATTGTATCAACATTTGTGCAATCTAAACCAAATACCTCT
CTAGCAATAGAGAG
■■Homology search results ■■ -
sp_hit_id P48430
Definition sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus
Align length 79
Score (bit) 32.3
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913254|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C02.
(614 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus... 32 2.0
sp|Q5FUA3|LPXB_GLUOX Lipid-A-disaccharide synthase OS=Gluconobac... 32 3.4
sp|Q7U8R5|KAIA_SYNPX Circadian clock protein kaiA OS=Synechococc... 32 3.4
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 ... 30 9.8

>sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus
GN=SOX2 PE=2 SV=1
Length = 315

Score = 32.3 bits (72), Expect = 2.0
Identities = 19/79 (24%), Positives = 36/79 (45%)
Frame = +3

Query: 174 QHPSVFSHNILAFLPPSTKQLQISHLHFQPATIISIFQQYHPTVADRSRSTKSDPALANS 353
QHP + +HN P + +S L + T + PT + S S + P +A
Sbjct: 180 QHPGLNAHNAAQMQP--MHRYDVSALQYNSMTSSQTYMNGSPTYS-MSYSQQGTPGMALG 236

Query: 354 ALGSIILTSVFRFQPIIST 410
++GS++ T P++++
Sbjct: 237 SMGSVVKTESSSSPPVVTS 255


>sp|Q5FUA3|LPXB_GLUOX Lipid-A-disaccharide synthase OS=Gluconobacter
oxydans GN=lpxB PE=3 SV=1
Length = 415

Score = 31.6 bits (70), Expect = 3.4
Identities = 22/102 (21%), Positives = 47/102 (46%), Gaps = 1/102 (0%)
Frame = +3

Query: 138 PLGSGVVSTLQTQHPSVFSHNILA-FLPPSTKQLQISHLHFQPATIISIFQQYHPTVADR 314
P+ ++ L+ Q+P + +A + P+ +QL I QP + I ++ A +
Sbjct: 232 PVFRKMLDILRVQYPDICPVIPVAPVIAPTIRQL-IRKWPIQPHIVTDIHDKHDAFAAAQ 290

Query: 315 SRSTKSDPALANSALGSIILTSVFRFQPIISTLDVGISRAAH 440
TKS + A+G++ + +R P+ +T+ + + H
Sbjct: 291 CALTKSGTSTLELAMGNVPMAVTYRVNPVTATIARRLIKVPH 332


>sp|Q7U8R5|KAIA_SYNPX Circadian clock protein kaiA OS=Synechococcus
sp. (strain WH8102) GN=kaiA PE=3 SV=1
Length = 296

Score = 31.6 bits (70), Expect = 3.4
Identities = 17/51 (33%), Positives = 26/51 (50%)
Frame = +3

Query: 279 IFQQYHPTVADRSRSTKSDPALANSALGSIILTSVFRFQPIISTLDVGISR 431
+ + T D S SDPA +N AL S + T+ F PI T+D+ + +
Sbjct: 178 LLESLQRTYRDLLISYFSDPAASNQALESFVNTAFFSDLPITRTVDIHVDQ 228


>sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1
OS=Schizosaccharomyces pombe GN=shk1 PE=1 SV=2
Length = 658

Score = 30.0 bits (66), Expect = 9.8
Identities = 31/135 (22%), Positives = 52/135 (38%), Gaps = 24/135 (17%)
Frame = +3

Query: 147 SGVVSTLQTQHPSVFSHNILAFLPPSTKQLQ----------------------ISHLHFQ 260
SG+ + Q QHP + +AF S K L+ S H Q
Sbjct: 182 SGITKSEQVQHPQAVL-DAMAFYSQSKKYLEEGAKPPFPRESTEKPLLSVSALSSSSHLQ 240

Query: 261 PATIISIFQQYHPT--VADRSRSTKSDPALANSALGSIILTSVFRFQPIISTLDVGISRA 434
P + S + +P+ S+ S P L++ + + + + P++S+
Sbjct: 241 PTSATSSSSRLYPSRPAPTPPASSSSSPLLSSQTVKTTTSNASRQPSPLVSSKSTDNIIR 300

Query: 435 AHSLIKLQIQTQSTS 479
+HS + L QT STS
Sbjct: 301 SHSPVLLTPQTLSTS 315


tr_hit_id Q29BX9
Definition tr|Q29BX9|Q29BX9_DROPS GA13045 OS=Drosophila pseudoobscura pseudoobscura
Align length 80
Score (bit) 35.8
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913254|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C02.
(614 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q29BX9|Q29BX9_DROPS GA13045 OS=Drosophila pseudoobscura pseud... 36 2.0
tr|A9V3R0|A9V3R0_MONBE Predicted protein OS=Monosiga brevicollis... 36 2.0
tr|Q173V0|Q173V0_AEDAE Bride of sevenless protein OS=Aedes aegyp... 35 3.5
tr|B0VGT4|B0VGT4_9BACT DegT/DnrJ/EryC1/StrS family protein OS=Ca... 34 7.7
tr|Q8NIR9|Q8NIR9_NEUCR Putative uncharacterized protein G15D1.06... 34 7.7

>tr|Q29BX9|Q29BX9_DROPS GA13045 OS=Drosophila pseudoobscura
pseudoobscura GN=GA13045 PE=4 SV=2
Length = 880

Score = 35.8 bits (81), Expect = 2.0
Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 2/80 (2%)
Frame = +3

Query: 132 RRPLGSGVVSTLQTQHPSVF--SHNILAFLPPSTKQLQISHLHFQPATIISIFQQYHPTV 305
+R + SG++ +L H V +HN+L P T Q + + L + + F H T
Sbjct: 774 KRNIDSGLIRSLNELHRDVLLMAHNVLLAYKPHTTQHKTARLFLEDVQALKEFSVGHETA 833

Query: 306 ADRSRSTKSDPALANSALGS 365
+ ST + A A+ GS
Sbjct: 834 PSSTASTSTPAANASGPSGS 853


>tr|A9V3R0|A9V3R0_MONBE Predicted protein OS=Monosiga brevicollis
GN=9576 PE=4 SV=1
Length = 445

Score = 35.8 bits (81), Expect = 2.0
Identities = 27/76 (35%), Positives = 33/76 (43%), Gaps = 2/76 (2%)
Frame = +2

Query: 368 HPHQRIQISAHHQHPRRWH*QGSP*PHQVADSDPIHEH--LRFQSVFSLSDESICRKVSS 541
H H + Q H HP + H Q P PH P H FQSV + S V S
Sbjct: 49 HAHSQHQHPHHPHHPHQHH-QHHPPPHHPHQHHPQHHEPPPEFQSVTPMGTPS---NVRS 104

Query: 542 TSEHLDPLYQHLCNLN 589
S H DP +H C+L+
Sbjct: 105 ESNH-DPSTKHRCDLS 119


>tr|Q173V0|Q173V0_AEDAE Bride of sevenless protein OS=Aedes aegypti
GN=AAEL007004 PE=4 SV=1
Length = 947

Score = 35.0 bits (79), Expect = 3.5
Identities = 22/65 (33%), Positives = 35/65 (53%)
Frame = +3

Query: 354 ALGSIILTSVFRFQPIISTLDVGISRAAHSLIKLQIQTQSTSICVFSQSLASQMKAFAAR 533
A+ SI+ + + P S+ D+ S+AAH L +L ++SI V S+S + K A
Sbjct: 280 AVQSIVDSLDYNIYPFPSSNDLLYSKAAHLLYELPWSNPNSSIAVRSESAETSNKFTAIC 339

Query: 534 SHQHL 548
H+HL
Sbjct: 340 RHEHL 344


>tr|B0VGT4|B0VGT4_9BACT DegT/DnrJ/EryC1/StrS family protein
OS=Candidatus Cloacamonas acidaminovorans GN=CLOAM0659
PE=4 SV=1
Length = 405

Score = 33.9 bits (76), Expect = 7.7
Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 9/88 (10%)
Frame = +3

Query: 138 PLGSGVVSTLQTQHPSVFSHNILAF---LPPSTKQLQISHLHFQPATI------ISIFQQ 290
PL + +T + HP F HN++ + LP L + + P + I+Q
Sbjct: 257 PLAKHLTTTAKKPHPWKFEHNMIGYNYRLPNINAALGCAQMEMLPEILKNKRETAHIYQD 316

Query: 291 YHPTVADRSRSTKSDPALANSALGSIIL 374
+ T+ D + T+ + ++N L +I+L
Sbjct: 317 FFQTITDINFITEPEDCISNYWLNAILL 344


>tr|Q8NIR9|Q8NIR9_NEUCR Putative uncharacterized protein G15D1.060
(Predicted protein) OS=Neurospora crassa GN=G15D1.060
PE=4 SV=1
Length = 815

Score = 33.9 bits (76), Expect = 7.7
Identities = 25/74 (33%), Positives = 31/74 (41%)
Frame = +3

Query: 120 AKL*RRPLGSGVVSTLQTQHPSVFSHNILAFLPPSTKQLQISHLHFQPATIISIFQQYHP 299
AK P S +T T HPS SHN F P+T LH PAT F +HP
Sbjct: 615 AKSFHTPATSHTPATFHTFHPSATSHNSATFHTPAT-------LH-TPAT----FHTFHP 662

Query: 300 TVADRSRSTKSDPA 341
+ + +PA
Sbjct: 663 SATSHDSAIAHNPA 676