BP913255
Clone id YMU001_000028_C03
Library
Length 611
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGTGTCTAAAGATTTGAGGTTTGCTTGTTAAGTTACAAAAAATGACTTTGAGCAAGTCTG
CTTCCTGCATATTACTGGCTATTTAAACAAAGGTAACCATGCAAAAGAAACCAGGAATGA
AGGAGCGTGACCTGTGTGTCAAAATTCTTACTGAGGGAGCAGATAAATTTACCAAGCAAA
GGCTCAAACAGCCTCTAAAGCTTTCTTGGGCTTCTGTGCTAGAAGCTGCATGATCCTTGG
CTGGTCAAGGGAGGGTGTATGTACAAAGCTTCATCTGGTGGGTGATTGTAGGTGGTGCGC
GTTATCTAAAACGCCATCAATAAATTGATATACAGCACGAATAAATATACAAGGAATCGA
GAGTCACTATAATACAGCTCCACCAAGGACTTGAATTTGGGAGGAACAAGGTGCTAGAAG
CGGCGCACGACATATGCTAGAAGCAAAGTGTATCCCCTTCCTGGATCCAATTCACGAAGT
GTTCAGAGAGCAGACAATCGTGTTTTTCTCTCTCTTGCAATCTGTTAGATTTTGTATTTG
GCAATACATATGAAAAGTCTTTGAAATATTCGTCAGACTCGAATCTGTTGTCTGGCTCTG
TATCGGGGTTG
■■Homology search results ■■ -
sp_hit_id Q09841
Definition sp|Q09841|PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe
Align length 81
Score (bit) 34.3
E-value 0.52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913255|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C03.
(611 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q09841|PSB7_SCHPO Probable proteasome subunit beta type-7 OS=... 34 0.52
sp|Q3Z4Y6|THII_SHISS Thiamine biosynthesis protein thiI OS=Shige... 31 4.4
sp|Q83SG1|THII_SHIFL Thiamine biosynthesis protein thiI OS=Shige... 31 4.4
sp|Q0T7G6|THII_SHIF8 Thiamine biosynthesis protein thiI OS=Shige... 31 4.4
sp|Q32JI1|THII_SHIDS Thiamine biosynthesis protein thiI OS=Shige... 31 4.4
sp|Q325H8|THII_SHIBS Thiamine biosynthesis protein thiI OS=Shige... 31 4.4
sp|Q1RFB7|THII_ECOUT Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|P77718|THII_ECOLI Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|B1J026|THII_ECOLC Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|Q8FKB7|THII_ECOL6 Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|A1A892|THII_ECOK1 Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|A7ZX76|THII_ECOHS Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|A7ZIH7|THII_ECO24 Thiamine biosynthesis protein thiI OS=Esche... 31 4.4
sp|A8AK31|THII_CITK8 Thiamine biosynthesis protein thiI OS=Citro... 31 4.4
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN... 31 5.7
sp|Q876A6|AKR1_SACCA Palmitoyltransferase AKR1 (Fragments) OS=Sa... 31 5.7
sp|Q8XE74|THII_ECO57 Thiamine biosynthesis protein thiI OS=Esche... 30 7.5
sp|Q46205|HYPA_CLOPE Protein hypA OS=Clostridium perfringens GN=... 30 7.5
sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytop... 30 9.7
sp|Q5RCG0|CE044_PONAB UPF0533 protein C5orf44 homolog OS=Pongo a... 30 9.7
sp|A5PLN9|CE044_HUMAN UPF0533 protein C5orf44 OS=Homo sapiens GN... 30 9.7

>sp|Q09841|PSB7_SCHPO Probable proteasome subunit beta type-7
OS=Schizosaccharomyces pombe GN=SPAC23D3.07 PE=2 SV=1
Length = 267

Score = 34.3 bits (77), Expect = 0.52
Identities = 22/81 (27%), Positives = 32/81 (39%), Gaps = 11/81 (13%)
Frame = +2

Query: 179 KAQTASKAFLGFCARSCMILGWSREGV---------CTKLHLVGDCRWCALSKTPSIN*Y 331
KA + +G A+ C++LG C KLHL+ WCA + T + +
Sbjct: 30 KATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLISPNIWCAGAGTAADTEF 89

Query: 332 TARINIQGIESH--YNTAPPR 388
+ IE H Y PR
Sbjct: 90 VTSMISSNIELHSLYTNRKPR 110


>sp|Q3Z4Y6|THII_SHISS Thiamine biosynthesis protein thiI OS=Shigella
sonnei (strain Ss046) GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|Q83SG1|THII_SHIFL Thiamine biosynthesis protein thiI OS=Shigella
flexneri GN=thiI PE=3 SV=2
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|Q0T7G6|THII_SHIF8 Thiamine biosynthesis protein thiI OS=Shigella
flexneri serotype 5b (strain 8401) GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|Q32JI1|THII_SHIDS Thiamine biosynthesis protein thiI OS=Shigella
dysenteriae serotype 1 (strain Sd197) GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|Q325H8|THII_SHIBS Thiamine biosynthesis protein thiI OS=Shigella
boydii serotype 4 (strain Sb227) GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|Q1RFB7|THII_ECOUT Thiamine biosynthesis protein thiI
OS=Escherichia coli (strain UTI89 / UPEC) GN=thiI PE=3
SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|P77718|THII_ECOLI Thiamine biosynthesis protein thiI
OS=Escherichia coli (strain K12) GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|B1J026|THII_ECOLC Thiamine biosynthesis protein thiI
OS=Escherichia coli (strain ATCC 8739 / DSM 1576 /
Crooks) GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


>sp|Q8FKB7|THII_ECOL6 Thiamine biosynthesis protein thiI
OS=Escherichia coli O6 GN=thiI PE=3 SV=1
Length = 482

Score = 31.2 bits (69), Expect = 4.4
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +2

Query: 422 GARHMLEAKCIPFLDPIHEVFREQTIVFFSLLQSVRFCI 538
G H+LE + +PF D +H++F + + + L+ FC+
Sbjct: 72 GIHHILEVEDVPFTD-MHDIFEKALVQYRDQLEGKTFCV 109


tr_hit_id A6QTS5
Definition tr|A6QTS5|A6QTS5_AJECN Predicted protein OS=Ajellomyces capsulata (strain NAm1 / WU24)
Align length 87
Score (bit) 35.0
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913255|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C03.
(611 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6QTS5|A6QTS5_AJECN Predicted protein OS=Ajellomyces capsulat... 35 3.4
tr|B1VXW5|B1VXW5_STRGG Putative transposase OS=Streptomyces gris... 34 5.8
tr|B6JX89|B6JX89_SCHJP Proteasome subunit beta type-7 OS=Schizos... 33 10.0

>tr|A6QTS5|A6QTS5_AJECN Predicted protein OS=Ajellomyces capsulata
(strain NAm1 / WU24) GN=HCAG_00781 PE=4 SV=1
Length = 859

Score = 35.0 bits (79), Expect = 3.4
Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 5/87 (5%)
Frame = -2

Query: 379 SCIIVTLDSLYIYSC----CISIY*WRFR*RAPPTITHQMKLCTYTLP*-PAKDHAASST 215
+C++ + +Y+ + I ++ W+F P + H++ C Y +P ++D+ S+T
Sbjct: 599 TCLLAAVTKMYLATRNPKGVIQVFQWKF----PFVVFHELPACRYYVPLHESEDNGVSAT 654

Query: 214 EAQESFRGCLSLCLVNLSAPSVRILTH 134
+ S RG +C+ + V IL H
Sbjct: 655 LFRSSRRGDELVCITTWTQSGVPILAH 681


>tr|B1VXW5|B1VXW5_STRGG Putative transposase OS=Streptomyces griseus
subsp. griseus (strain JCM 4626 / NBRC 13350)
GN=SGR_1752 PE=4 SV=1
Length = 93

Score = 34.3 bits (77), Expect = 5.8
Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 5/63 (7%)
Frame = +2

Query: 218 ARSCMILGWSREGVCTKLHLVGDCRWCALS--KTP-SIN*YTARINI-QGIES-HYNTAP 382
+++C LG SR G+ TK+HL DCR LS TP +N TA ++ +G+ + T
Sbjct: 12 SQACQALGRSRGGLTTKVHLAVDCRGLPLSIVLTPGGVNDATAFADVLKGVRTPRAGTGR 71

Query: 383 PRT 391
PRT
Sbjct: 72 PRT 74


>tr|B6JX89|B6JX89_SCHJP Proteasome subunit beta type-7
OS=Schizosaccharomyces japonicus yFS275 GN=SJAG_01014
PE=4 SV=1
Length = 270

Score = 33.5 bits (75), Expect = 10.0
Identities = 21/88 (23%), Positives = 34/88 (38%), Gaps = 11/88 (12%)
Frame = +2

Query: 158 SR*IYQAKAQTASKAFLGFCARSCMILGWSREGV---------CTKLHLVGDCRWCALSK 310
+R + KA + +G A+ C++LG C KLH + WCA +
Sbjct: 26 NRGVPMPKATSTGTTIVGLIAKDCLVLGADTRATAGPTIADKNCEKLHYISPNIWCAGAG 85

Query: 311 TPSIN*YTARINIQGIESH--YNTAPPR 388
T + + + +E H Y PR
Sbjct: 86 TAADTEFVTALTSSNVELHSMYVNRKPR 113