BP913259
Clone id YMU001_000028_C07
Library
Length 584
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_C07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTAGATATTACCTGCAGGTACTCTAACTGAACAAAATGGGCGAGGTATAAGTGGAGGAGC
TGTAGATAAAGAGCATACCGCAAAGTGTTGGGCTTCGTACTATGATGAGTGGAAGTAGGA
TGCACACCAGAGACCCAATGGCTGAAGGATCGACGATTGTGCTTCGTACCAGAAGCACTC
TGAGCAGAACCATAGTCCTCACAGGATGCAGCATAATATGCAAACCAAAACATGTAATAT
TCAAAAAGGTCAAGCTGTAGCTGCAGGCCACCCACATTAGAGACCTTCGTGCGGTTCTTA
AAGAGCTCAGAGGTATGAGAAAGAAGGGTTACCCCTCTGTCCAACAAAAGCAACTGGCGT
ACCCGAAGAGGAAGGCGTCCATTAGGGAAAACAAACTGTACTGCTTTCTCACGATCAAGA
GCAAGAAGAGAAACAAACAAATGACCTGACGGGTGAAGCAGGGAGCGAAGAGCACTTACT
GATTGCTCATCTGTTGCCCTCACCAGCCATGCAGATGAGGAAGATGAAGCAGAATCATGG
AAGCCAAATACCTTCTGAAGCAACACAGGGAAACACAGCCGGAA
■■Homology search results ■■ -
sp_hit_id Q14781
Definition sp|Q14781|CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens
Align length 57
Score (bit) 38.1
E-value 0.032
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913259|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C07.
(584 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q14781|CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens... 38 0.032
sp|P30658|CBX2_MOUSE Chromobox protein homolog 2 OS=Mus musculus... 36 0.16
sp|Q6ZPR5|NSMA3_MOUSE Sphingomyelin phosphodiesterase 4 OS=Mus m... 33 1.0
sp|Q4WEU2|RPC3_ASPFU DNA-directed RNA polymerase III subunit rpc... 33 1.4
sp|Q4WZP2|CSN5_ASPFU COP9 signalosome complex subunit 5 OS=Asper... 32 2.3
sp|Q9NXE4|NSMA3_HUMAN Sphingomyelin phosphodiesterase 4 OS=Homo ... 32 3.0
sp|Q8VE97|SFRS4_MOUSE Splicing factor, arginine/serine-rich 4 OS... 31 3.9
sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens GN... 31 5.2
sp|O88286|WIZ_MOUSE Protein Wiz OS=Mus musculus GN=Wiz PE=1 SV=2 30 6.7

>sp|Q14781|CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens
GN=CBX2 PE=1 SV=2
Length = 532

Score = 38.1 bits (87), Expect = 0.032
Identities = 19/57 (33%), Positives = 33/57 (57%)
Frame = +1

Query: 364 RRGRRPLGKTNCTAFSRSRARRETNK*PDG*SRERRALTDCSSVALTSHADEEDEAE 534
+RG+RP G+ S +RR K PD S+ + + + SS + +S +DEED+++
Sbjct: 71 KRGKRPRGRPRKLTAMSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEDDSD 127


>sp|P30658|CBX2_MOUSE Chromobox protein homolog 2 OS=Mus musculus
GN=Cbx2 PE=1 SV=1
Length = 519

Score = 35.8 bits (81), Expect = 0.16
Identities = 18/55 (32%), Positives = 32/55 (58%)
Frame = +1

Query: 364 RRGRRPLGKTNCTAFSRSRARRETNK*PDG*SRERRALTDCSSVALTSHADEEDE 528
+RG+RP G+ + S +RR K PD S+ + + + SS + +S +DEE++
Sbjct: 71 KRGKRPRGRPRKHTATSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEED 125


>sp|Q6ZPR5|NSMA3_MOUSE Sphingomyelin phosphodiesterase 4 OS=Mus
musculus GN=Smpd4 PE=2 SV=2
Length = 823

Score = 33.1 bits (74), Expect = 1.0
Identities = 35/124 (28%), Positives = 47/124 (37%), Gaps = 6/124 (4%)
Frame = -1

Query: 572 FPVLLQKVFGFHDXXXXXXXAWLVRATDEQ----SVSALRSLLHPSGHLFVSLLALDREK 405
FP L++ +FG D W +R + S L PSG + + L E
Sbjct: 48 FPWLVESIFGSLDGVLVG---WNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED 104

Query: 404 AVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGGLQLQLDL--FEYYM 231
F FP + S L+ N+ + GGL L L L FEYYM
Sbjct: 105 -YNFDFPVSCLPGPVKASIQEN-----VLPDSPLYHNKVQFPPTGGLGLNLALNPFEYYM 158

Query: 230 FWFA 219
F+FA
Sbjct: 159 FYFA 162


>sp|Q4WEU2|RPC3_ASPFU DNA-directed RNA polymerase III subunit rpc3
OS=Aspergillus fumigatus GN=rpc82 PE=3 SV=1
Length = 629

Score = 32.7 bits (73), Expect = 1.4
Identities = 18/46 (39%), Positives = 25/46 (54%)
Frame = +2

Query: 347 KATGVPEEEGVH*GKQTVLLSHDQEQEEKQTNDLTGEAGSEEHLLI 484
KA GVPEE G H E++E+Q+N L GE +E+ L+
Sbjct: 135 KANGVPEEHGEH------------EEDEEQSNGLNGEHSNEQPELL 168


>sp|Q4WZP2|CSN5_ASPFU COP9 signalosome complex subunit 5
OS=Aspergillus fumigatus GN=csn5 PE=3 SV=2
Length = 334

Score = 32.0 bits (71), Expect = 2.3
Identities = 15/55 (27%), Positives = 27/55 (49%)
Frame = -1

Query: 275 VGGLQLQLDLFEYYMFWFAYYAASCEDYGSAQSASGTKHNRRSFSHWVSGVHPTS 111
V G + +++ E + Y SC D G ++A G H+ + W+SG+ T+
Sbjct: 96 VEGTETRVNAQEEANEYMVSYLQSCRDAGRMENAVGWYHSHPGYGCWLSGIDVTT 150


>sp|Q9NXE4|NSMA3_HUMAN Sphingomyelin phosphodiesterase 4 OS=Homo
sapiens GN=SMPD4 PE=1 SV=2
Length = 827

Score = 31.6 bits (70), Expect = 3.0
Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 2/33 (6%)
Frame = -1

Query: 311 SELFKNRTKVSNVGGLQLQLDL--FEYYMFWFA 219
S L+ N+ + + GGL L L L FEYY+F+FA
Sbjct: 130 SPLYHNKVQFTPTGGLGLNLALNPFEYYIFFFA 162


>sp|Q8VE97|SFRS4_MOUSE Splicing factor, arginine/serine-rich 4
OS=Mus musculus GN=Sfrs4 PE=2 SV=1
Length = 489

Score = 31.2 bits (69), Expect = 3.9
Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 2/62 (3%)
Frame = +1

Query: 343 NKSNWRTRRGRRPLGKTNCTAFSRSRARRETNK*P--DG*SRERRALTDCSSVALTSHAD 516
+KS R+R G K+ + SRSR+++E ++ P D SR R D S HA+
Sbjct: 216 SKSRSRSRSGSHSRSKSRSRSQSRSRSKKEKSRSPSKDNKSRSRSRSPDKSRSKSKDHAE 275

Query: 517 EE 522
++
Sbjct: 276 DK 277


>sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens
GN=ZNF394 PE=2 SV=2
Length = 561

Score = 30.8 bits (68), Expect = 5.2
Identities = 23/86 (26%), Positives = 36/86 (41%)
Frame = +2

Query: 290 CGS*RAQRYEKEGLPLCPTKATGVPEEEGVH*GKQTVLLSHDQEQEEKQTNDLTGEAGSE 469
CGS R EK+ P K PE EG++ V + E E+ + N+L A
Sbjct: 235 CGSTHEDRVEKQSGDPLPLKLENSPEAEGLN-SISDVNKNGSIEGEDSKNNELQNSARCS 293

Query: 470 EHLLIAHLLPSPAMQMRKMKQNHGSQ 547
+L H+ P + + HG++
Sbjct: 294 NLVLCQHI---PKAERPTDSEEHGNK 316


>sp|O88286|WIZ_MOUSE Protein Wiz OS=Mus musculus GN=Wiz PE=1 SV=2
Length = 1684

Score = 30.4 bits (67), Expect = 6.7
Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
Frame = +2

Query: 401 LLSHDQEQEEKQT-----NDLTGEAGSEEHLLIAHLLPSPAMQMRKMKQNHGSQIPSEAT 565
L S ++E+E++ D T E G+ L I L+P PA+++++ Q+ + + T
Sbjct: 598 LWSEEEEEEDEDVVLTSERDFTPENGAFPPLAIPSLIPQPALELKQTFQDALQAVDASET 657

Query: 566 Q 568
Q
Sbjct: 658 Q 658


tr_hit_id A9U4C0
Definition tr|A9U4C0|A9U4C0_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 156
Score (bit) 109.0
E-value 1.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913259|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_C07.
(584 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9U4C0|A9U4C0_PHYPA Predicted protein OS=Physcomitrella paten... 109 1e-22
tr|A5AEB8|A5AEB8_VITVI Putative uncharacterized protein OS=Vitis... 78 4e-13
tr|Q2A9S4|Q2A9S4_BRAOL Putative uncharacterized protein OS=Brass... 64 6e-09
tr|A7QY23|A7QY23_VITVI Chromosome undetermined scaffold_237, who... 60 1e-07
tr|Q9LVR9|Q9LVR9_ARATH Arabidopsis thaliana genomic DNA, chromos... 59 3e-07
tr|A4SAJ3|A4SAJ3_OSTLU Predicted protein OS=Ostreococcus lucimar... 58 4e-07
tr|B8A0H4|B8A0H4_MAIZE Putative uncharacterized protein OS=Zea m... 53 1e-05
tr|Q8SBA5|Q8SBA5_ORYSA Putative uncharacterized protein OSJNBa00... 50 1e-04
tr|Q7XC65|Q7XC65_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 50 1e-04
tr|A3C7A7|A3C7A7_ORYSJ Putative uncharacterized protein OS=Oryza... 50 1e-04
tr|A2ZA77|A2ZA77_ORYSI Putative uncharacterized protein OS=Oryza... 50 1e-04
tr|B7Q265|B7Q265_IXOSC Sphingomyelin phosphodiesterase, putative... 47 0.001
tr|Q1ZHH8|Q1ZHH8_9GAMM Glutaminyl-tRNA synthetase OS=Psychromona... 37 1.1
tr|A2ABG2|A2ABG2_MOUSE Hromobox homolog 2 (Drosophila Pc class) ... 36 1.4
tr|Q0IVP9|Q0IVP9_ORYSJ Os10g0560500 protein (Fragment) OS=Oryza ... 36 1.8
tr|A1SS83|A1SS83_PSYIN Glutaminyl-tRNA synthetase OS=Psychromona... 35 2.4
tr|Q0YR75|Q0YR75_9CHLB Putative uncharacterized protein OS=Chlor... 35 3.1
tr|B6NPU2|B6NPU2_BRAFL Putative uncharacterized protein OS=Branc... 35 3.1
tr|Q7Q683|Q7Q683_ANOGA AGAP005987-PA OS=Anopheles gambiae GN=AGA... 34 5.2
tr|B6LS08|B6LS08_BRAFL Putative uncharacterized protein OS=Branc... 34 6.9
tr|Q3TZG6|Q3TZG6_MOUSE Putative uncharacterized protein OS=Mus m... 33 9.0
tr|Q69TJ2|Q69TJ2_ORYSJ Putative uncharacterized protein OSJNBa00... 33 9.0

>tr|A9U4C0|A9U4C0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_156144 PE=4 SV=1
Length = 586

Score = 109 bits (272), Expect = 1e-22
Identities = 67/156 (42%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
Frame = -1

Query: 584 FRLCFPVLLQKVFGFHDXXXXXXXA-----WLVRAT---DEQSVSALRSLLHPSGHLFVS 429
+RLCFPV+L+K+FGF D A WL +A+ +E + AL SLL P G LF S
Sbjct: 31 YRLCFPVVLRKIFGFEDSSAASQPASSAGGWLAQASVPGNEATTRALISLLSPRGSLFSS 90

Query: 428 LLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGG--LQLQ 255
LLA+D+E V++VFP +G +L S+LFK+R G LQ+
Sbjct: 91 LLAVDKENFVRYVFPMERLPEWVRNLLSQEKGAHILCQVSDLFKSRIMEDANGMCILQVH 150

Query: 254 LDLFEYYMFWFAYYAASCEDYGSAQSASGTKHNRRS 147
LD+FEYYMFWFAYYA C+D Q A+G + RS
Sbjct: 151 LDVFEYYMFWFAYYAV-CKDQNQRQRAAGGRRTSRS 185


>tr|A5AEB8|A5AEB8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033417 PE=4 SV=1
Length = 862

Score = 77.8 bits (190), Expect = 4e-13
Identities = 50/162 (30%), Positives = 76/162 (46%), Gaps = 8/162 (4%)
Frame = -1

Query: 584 FRLCFPVLLQKVFGFHDXXXXXXXA---WL---VRATDEQSVSALRSLLHPSGHLFVSLL 423
F + FP L+ K+FGF D + W+ + D S + +LL P L S+
Sbjct: 53 FSIAFPTLICKLFGFDDSSPQNPNSPNGWIDAVFASNDRDFASRVFNLLSPDSVLMQSIS 112

Query: 422 ALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGG--LQLQLD 249
A+DR+ V++VFP R +L LFK R K +V G Q+QL+
Sbjct: 113 AVDRQSLVKYVFPVERLPEWVRFVLQSNRDCRILPDLCPLFKGRVKEDSVKGTSFQIQLN 172

Query: 248 LFEYYMFWFAYYAASCEDYGSAQSASGTKHNRRSFSHWVSGV 123
+FEYYMFWF+YY + +++ + K R +W S +
Sbjct: 173 VFEYYMFWFSYYPVCKGNSENSREIAVRKSRRFRLENWTSSI 214


>tr|Q2A9S4|Q2A9S4_BRAOL Putative uncharacterized protein OS=Brassica
oleracea GN=25.t00068 PE=4 SV=1
Length = 1161

Score = 63.9 bits (154), Expect = 6e-09
Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 10/134 (7%)
Frame = -1

Query: 584 FRLCFPVLLQKVFGFHDXXXXXXXA-------WL--VRATDEQSVSA-LRSLLHPSGHLF 435
F + FP L+ K+FGF D W+ + AT++ +S + SLL PSG L
Sbjct: 53 FSITFPSLICKIFGFGDATAPSPAQSSSPQNGWIDVITATNDSDLSGRVFSLLSPSGILM 112

Query: 434 VSLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGGLQLQ 255
S+ A+D+ V++VFP + T LS+ K K+ +++
Sbjct: 113 SSIFAVDKLSLVKYVFPTERLPEYARFMLSSEKDRTALSNLCPFLKG--KIEEGASYEVR 170

Query: 254 LDLFEYYMFWFAYY 213
L++FEYYMFW +YY
Sbjct: 171 LNVFEYYMFWLSYY 184


>tr|A7QY23|A7QY23_VITVI Chromosome undetermined scaffold_237, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00009520001 PE=4 SV=1
Length = 656

Score = 59.7 bits (143), Expect = 1e-07
Identities = 34/105 (32%), Positives = 52/105 (49%), Gaps = 2/105 (1%)
Frame = -1

Query: 431 SLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGG--LQL 258
S+ A+DR+ V++VFP R +L LFK R K +V G Q+
Sbjct: 3 SISAVDRQSLVKYVFPVERLPEWVRFVLQSNRDCRILPDLCPLFKGRVKEDSVKGTSFQI 62

Query: 257 QLDLFEYYMFWFAYYAASCEDYGSAQSASGTKHNRRSFSHWVSGV 123
QL++FEYYMFWF+YY + +++ + K R +W S +
Sbjct: 63 QLNVFEYYMFWFSYYPVCKGNSENSREIAVRKSRRFRLENWTSSI 107


>tr|Q9LVR9|Q9LVR9_ARATH Arabidopsis thaliana genomic DNA, chromosome
5, P1 clone:MQL5 OS=Arabidopsis thaliana GN=At5g47400
PE=4 SV=1
Length = 665

Score = 58.5 bits (140), Expect = 3e-07
Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 13/137 (9%)
Frame = -1

Query: 584 FRLCFPVLLQKVFGFHDXXXXXXXA--------WL---VRATDEQSVSALRSLLHPSGHL 438
F + FP L+ K+FGF D W+ A D + +LL PSG L
Sbjct: 120 FSVTFPSLICKIFGFGDTTAASPAQSSSLRPNGWIDVISAANDLDLAERVYNLLSPSGIL 179

Query: 437 FVSLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGG--L 264
S+ A+D+ V++VFP + LS+ K + + +V G
Sbjct: 180 MSSIFAVDKLALVKYVFPTERLPEYARFMLSSEKDRIALSNLCPFLKGKIEEDSVRGSLC 239

Query: 263 QLQLDLFEYYMFWFAYY 213
+++L++FEYYMFW +YY
Sbjct: 240 EVRLNVFEYYMFWLSYY 256


>tr|A4SAJ3|A4SAJ3_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_94029 PE=4 SV=1
Length = 954

Score = 57.8 bits (138), Expect = 4e-07
Identities = 43/156 (27%), Positives = 62/156 (39%)
Frame = -1

Query: 584 FRLCFPVLLQKVFGFHDXXXXXXXAWLVRATDEQSVSALRSLLHPSGHLFVSLLALDREK 405
F CF +L ++F F E+ V L L P G L ++L D +K
Sbjct: 119 FSACFQPILCRLFSFDGSSSEGWMNAAFTTGSERDVKDLLDFLSPEGSLIRAMLIADSDK 178

Query: 404 AVQFVFPNGXXXXXXXXXXXXXRGVTLLSHTSELFKNRTKVSNVGGLQLQLDLFEYYMFW 225
VQF FP G L+ S + K +VG Q+ L L+ Y+MFW
Sbjct: 179 LVQFAFPLDRLPERTQRMLQTESGAMALNR-SPPYAGCIKRDSVGKYQVHLGLYHYFMFW 237

Query: 224 FAYYAASCEDYGSAQSASGTKHNRRSFSHWVSGVHP 117
AY+A G S+S + ++ + SG P
Sbjct: 238 TAYFA--MRPGGRRGSSSSSLYSAGQSPSYKSGSGP 271


>tr|B8A0H4|B8A0H4_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 746

Score = 52.8 bits (125), Expect = 1e-05
Identities = 40/135 (29%), Positives = 57/135 (42%), Gaps = 2/135 (1%)
Frame = -1

Query: 497 ATDEQSVSALRSLLHPSGHLFVSLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLS 318
A D + SL++P+G L + A DR +++VFP+ L
Sbjct: 72 AADPALGDLILSLIYPTGPLLAAAAAADRLTLIRYVFPSERLPDWLRLALASPPSTDL-- 129

Query: 317 HTSELFKNRTKVSNVGGLQLQLDLFEYYMFWFAYY-AASCEDYGSAQSASGTK-HNRRSF 144
S L R +L L +FEYY+FWFAYY +S A SAS + +R
Sbjct: 130 -ASPLLSRRV------ASELHLSVFEYYLFWFAYYPVSSASSAAPAASASNPRLTSRARL 182

Query: 143 SHWVSGVHPTSTHHS 99
WVS + T+ S
Sbjct: 183 ETWVSTLATTAIRKS 197


>tr|Q8SBA5|Q8SBA5_ORYSA Putative uncharacterized protein
OSJNBa0042H09.5 OS=Oryza sativa GN=OSJNBa0042H09.5 PE=4
SV=1
Length = 771

Score = 49.7 bits (117), Expect = 1e-04
Identities = 32/98 (32%), Positives = 43/98 (43%)
Frame = -1

Query: 497 ATDEQSVSALRSLLHPSGHLFVSLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLS 318
A D L SLL PSG L ++ A DR ++FVFP + S
Sbjct: 73 AGDPALAELLASLLAPSGPLLAAVSAADRHALLRFVFPPERLPDWLRLALSSATAASSSS 132

Query: 317 HTSELFKNRTKVSNVGGLQLQLDLFEYYMFWFAYYAAS 204
+S ++ +L L +FEYY+FWFAYY S
Sbjct: 133 SSSSDEVISPLLAGRVDSELHLSVFEYYLFWFAYYPIS 170


>tr|Q7XC65|Q7XC65_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os10g41120 PE=4 SV=2
Length = 594

Score = 49.7 bits (117), Expect = 1e-04
Identities = 32/98 (32%), Positives = 43/98 (43%)
Frame = -1

Query: 497 ATDEQSVSALRSLLHPSGHLFVSLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLS 318
A D L SLL PSG L ++ A DR ++FVFP + S
Sbjct: 73 AGDPALAELLASLLAPSGPLLAAVSAADRHALLRFVFPPERLPDWLRLALSSATAASSSS 132

Query: 317 HTSELFKNRTKVSNVGGLQLQLDLFEYYMFWFAYYAAS 204
+S ++ +L L +FEYY+FWFAYY S
Sbjct: 133 SSSSDEVISPLLAGRVDSELHLSVFEYYLFWFAYYPIS 170


>tr|A3C7A7|A3C7A7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_031179 PE=4 SV=1
Length = 771

Score = 49.7 bits (117), Expect = 1e-04
Identities = 32/98 (32%), Positives = 43/98 (43%)
Frame = -1

Query: 497 ATDEQSVSALRSLLHPSGHLFVSLLALDREKAVQFVFPNGXXXXXXXXXXXXXRGVTLLS 318
A D L SLL PSG L ++ A DR ++FVFP + S
Sbjct: 73 AGDPALAELLASLLAPSGPLLAAVSAADRHALLRFVFPPERLPDWLRLALSSATAASSSS 132

Query: 317 HTSELFKNRTKVSNVGGLQLQLDLFEYYMFWFAYYAAS 204
+S ++ +L L +FEYY+FWFAYY S
Sbjct: 133 SSSSDEVISPLLAGRVDSELHLSVFEYYLFWFAYYPIS 170