BP913272
Clone id YMU001_000028_D10
Library
Length 275
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_D10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCCGGTAAAGATATGTATAGATTTCAAGAAGACAATGACATATATGAAGATTGAAAGTA
AAATCTGAATAAAAGTTTGGATGAGGACTTGTCATGGCCAGAACTTGCCTCTGATAGGTC
AATCATAGGCGGAAGAGCTGACATAGAAACGAAGCAGTAAAATAATACCATCTACTTGAG
CTGTAACACTTTCAATGCTAGACCTCTCAATGGAAACTCCAGACATGTAGCAATACATGG
ATGGAGTACCTGCAGGTAATATCTCAAGGGCGAAT
■■Homology search results ■■ -
sp_hit_id Q51D88
Definition sp|Q51D88|PAP_ENTHI Poly(A) polymerase OS=Entamoeba histolytica
Align length 41
Score (bit) 29.6
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913272|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_D10.
(275 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q51D88|PAP_ENTHI Poly(A) polymerase OS=Entamoeba histolytica ... 30 4.9

>sp|Q51D88|PAP_ENTHI Poly(A) polymerase OS=Entamoeba histolytica
GN=16.t00038 PE=2 SV=1
Length = 522

Score = 29.6 bits (65), Expect = 4.9
Identities = 14/41 (34%), Positives = 27/41 (65%), Gaps = 2/41 (4%)
Frame = -2

Query: 238 MYCYMSGVSIE--RSSIESVTAQVDGIILLLRFYVSSSAYD 122
+YC+++G+SIE + + S Q+D + LL +F+ S++D
Sbjct: 205 VYCFLNGISIEILVAQVISENYQLDNVRLLEKFFQVYSSWD 245


tr_hit_id Q23E04
Definition tr|Q23E04|Q23E04_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 68
Score (bit) 33.1
E-value 7.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913272|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_D10.
(275 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q23E04|Q23E04_TETTH Putative uncharacterized protein OS=Tetra... 33 7.2

>tr|Q23E04|Q23E04_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00675560 PE=4
SV=2
Length = 1106

Score = 33.1 bits (74), Expect = 7.2
Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
Frame = +2

Query: 2 SGKDMYRFQE-DNDIYED*K*NLNKSLDEDLSWPELASDRSIIGGRADIETKQ*NNTIYL 178
S D+Y QE +ND + K +KS DED S+ SD + + IET+Q NN+ L
Sbjct: 643 SNSDLYYDQESENDDNDSLKQESDKSFDEDQSFSY--SDEENLDDKGFIETQQANNSSKL 700

Query: 179 SCNTFNAR 202
+ T + R
Sbjct: 701 NLTTKSKR 708