BP913304
Clone id YMU001_000028_G08
Library
Length 398
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATATTTGAGTGCAAGTCCAACCCTTGTCCCAGTCCCAAAGCTTGATCAACATATCGTCAG
AAGATGACAGCACATATGGTAACGTGGGATGCACTGCTACACACCTAATGTAGTCAGTGT
GAGCTTCTAACGTTCTAATTATGTCCATTGTATTATAATTGTATACACGAATGTTCATGT
CATCTGCCCCGGCAACAATCCATTGCTTTCTATGAATGAACTTTGCTGATCTGACAGGTA
GTTCTGTGACTTCAAAAGACTTGACTAGACTCTGGGATTGGTAATTCCAGATATAGACAC
TGCCTGTATACAAACTTGTAAGTATCCATGGCTCTGTGGGATGAAGGTCAACTGATTTCA
CTCGATCTGACCTTTGTGCGAGCTTTCGCTTTATCTCC
■■Homology search results ■■ -
sp_hit_id Q5VQ78
Definition sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica
Align length 132
Score (bit) 245.0
E-value 6.0e-65
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913304|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_G08.
(398 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa s... 245 6e-65
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa s... 243 3e-64
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza... 241 1e-63
sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis th... 240 1e-63
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis th... 240 2e-63
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis th... 238 5e-63
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=... 215 6e-56
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=... 215 6e-56
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicula... 215 6e-56
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=... 215 6e-56
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=CO... 215 6e-56
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus ... 213 3e-55
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium di... 209 4e-54
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorh... 197 2e-50
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melan... 194 1e-49
sp|P41811|COPB2_YEAST Coatomer subunit beta' OS=Saccharomyces ce... 178 6e-45
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizos... 169 4e-42
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium dis... 115 5e-26
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis th... 111 1e-24
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis th... 110 2e-24
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa s... 110 3e-24
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa s... 110 3e-24
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa s... 110 3e-24
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosa... 109 4e-24
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=C... 107 2e-23
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=C... 107 2e-23
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COP... 107 2e-23
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cer... 102 6e-22
sp|O61585|KTNB1_STRPU Katanin p80 WD40-containing subunit B1 OS=... 64 3e-10
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protei... 62 1e-09

>sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa
subsp. japonica GN=Os06g0143900 PE=2 SV=1
Length = 907

Score = 245 bits (625), Expect = 6e-65
Identities = 114/132 (86%), Positives = 124/132 (93%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRK AQRS+RVKSVDLHPTEPWIL+SLY+GSV IW+YQSQ++VKSFEV+ELPVRSAKF
Sbjct: 6 EIKRKFAQRSERVKSVDLHPTEPWILSSLYSGSVCIWDYQSQTMVKSFEVSELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 ISRKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDKGW CTQI
Sbjct: 126 WDWDKGWMCTQI 137



Score = 57.0 bits (136), Expect = 3e-08
Identities = 36/158 (22%), Positives = 68/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W++
Sbjct: 99 TDYIRCVAVHPTLPYVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTTKIWSLGSPDPNFTLDGHQKGVNCVDYFTGGDRPYLITGSDDSTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT I V HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIW 256



Score = 35.0 bits (79), Expect = 0.12
Identities = 16/68 (23%), Positives = 36/68 (52%)
Frame = -2

Query: 331 PWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNYN 152
P+++T + +W+YQ++S V++ E + + F I+ G++D +R+++
Sbjct: 200 PYLITGSDDSTAKVWDYQTKSCVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIWHST 259

Query: 151 TMDIIRTL 128
T + TL
Sbjct: 260 TYRLENTL 267



Score = 30.4 bits (67), Expect = 2.9
Identities = 12/40 (30%), Positives = 24/40 (60%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
++I R ++ ++ V +HPT P++LSS + +WD+
Sbjct: 5 LEIKRKFAQRSERVKSVDLHPTEPWILSSLYSGSVCIWDY 44


>sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa
subsp. japonica GN=Os02g0209100 PE=2 SV=1
Length = 910

Score = 243 bits (619), Expect = 3e-64
Identities = 113/132 (85%), Positives = 124/132 (93%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRKLAQRS+RVKSVDLHPTEPWIL+SLY+GSV IWNYQ+Q++VKSFEVTELPVRS+KF
Sbjct: 6 DIKRKLAQRSERVKSVDLHPTEPWILSSLYSGSVCIWNYQTQTMVKSFEVTELPVRSSKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQWIVAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPT P+VLSSSDDMLIKL
Sbjct: 66 IARKQWIVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTQPFVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDKGW CTQI
Sbjct: 126 WDWDKGWMCTQI 137



Score = 57.0 bits (136), Expect = 3e-08
Identities = 37/158 (23%), Positives = 66/158 (41%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT+P++L+S + +W++
Sbjct: 99 TDYIRCVAVHPTQPFVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ +V L F H K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTVKVWSLGSPDPNFTLDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + V HP LP L+ S+D ++LW
Sbjct: 219 KSCVQTLEGHAHNVSAVCFHPELPITLTGSEDGTVRLW 256



Score = 31.6 bits (70), Expect = 1.3
Identities = 13/40 (32%), Positives = 25/40 (62%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
+DI R L ++ ++ V +HPT P++LSS + +W++
Sbjct: 5 LDIKRKLAQRSERVKSVDLHPTEPWILSSLYSGSVCIWNY 44


>sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza
sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2
Length = 910

Score = 241 bits (614), Expect = 1e-63
Identities = 111/132 (84%), Positives = 123/132 (93%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRKLAQRS+R KSVDLHPTEPWIL+SLY+GSV IWNYQ+Q++VKSFEVTELPVRS+KF
Sbjct: 6 DIKRKLAQRSERAKSVDLHPTEPWILSSLYSGSVCIWNYQTQTMVKSFEVTELPVRSSKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPT P+VLSSSDDMLIKL
Sbjct: 66 ITRKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTQPFVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDKGW CTQI
Sbjct: 126 WDWDKGWMCTQI 137



Score = 58.2 bits (139), Expect = 1e-08
Identities = 37/158 (23%), Positives = 67/158 (42%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT+P++L+S + +W++
Sbjct: 99 TDYIRCVAVHPTQPFVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ +V L F H K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTVKVWSLGSPDPNFTLDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + V HP LP +L+ S+D ++LW
Sbjct: 219 KSCVQTLEGHAHNVSAVCFHPELPIILTGSEDGTVRLW 256



Score = 33.1 bits (74), Expect = 0.44
Identities = 17/68 (25%), Positives = 36/68 (52%)
Frame = -2

Query: 331 PWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNYN 152
P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 200 PYLITGSDDQTAKVWDYQTKSCVQTLEGHAHNVSAVCFHPELPIILTGSEDGTVRLWHST 259

Query: 151 TMDIIRTL 128
T + TL
Sbjct: 260 TYRLENTL 267



Score = 30.0 bits (66), Expect = 3.7
Identities = 13/40 (32%), Positives = 24/40 (60%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
+DI R L ++ + V +HPT P++LSS + +W++
Sbjct: 5 LDIKRKLAQRSERAKSVDLHPTEPWILSSLYSGSVCIWNY 44


>sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis
thaliana GN=At1g52360 PE=2 SV=1
Length = 926

Score = 240 bits (613), Expect = 1e-63
Identities = 110/132 (83%), Positives = 122/132 (92%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRKLAQRS+RVKSVDLHPTEPWIL SLY+G++ IWNYQ+Q + KSFEVTELPVRSAKF
Sbjct: 6 EIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RKQW+VAGADDM IRVYNYNTMD ++ EAH+DYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 VARKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDW+KGW CTQI
Sbjct: 126 WDWEKGWACTQI 137



Score = 58.9 bits (141), Expect = 8e-09
Identities = 36/158 (22%), Positives = 69/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
SD ++ V +HPT P++L+S + +W+++
Sbjct: 99 SDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT + V HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIW 256



Score = 35.0 bits (79), Expect = 0.12
Identities = 17/69 (24%), Positives = 37/69 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 199 KPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHA 258

Query: 154 NTMDIIRTL 128
T + TL
Sbjct: 259 TTYRLENTL 267



Score = 29.6 bits (65), Expect = 4.9
Identities = 20/73 (27%), Positives = 32/73 (43%)
Frame = -2

Query: 382 LAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQ 203
L + V +V HP P I+T G+V IW+ + L + V + +I +
Sbjct: 225 LEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSR 284

Query: 202 WIVAGADDMNIRV 164
+V G D+ I V
Sbjct: 285 RVVIGYDEGTIMV 297



Score = 28.9 bits (63), Expect = 8.3
Identities = 11/40 (27%), Positives = 25/40 (62%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
++I R L ++ ++ V +HPT P++L+S + +W++
Sbjct: 5 LEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNY 44


>sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis
thaliana GN=At1g79990 PE=2 SV=2
Length = 920

Score = 240 bits (612), Expect = 2e-63
Identities = 111/132 (84%), Positives = 122/132 (92%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRK AQRS+RVKSVDLHPTEPWIL SLY+G++ IWNYQ+Q++VKSF+VTELPVRSAKF
Sbjct: 6 EIKRKFAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQTMVKSFDVTELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD I+ EAH DYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 IARKQWVVAGADDMFIRVYNYNTMDKIKVFEAHADYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDW+KGW CTQI
Sbjct: 126 WDWEKGWLCTQI 137



Score = 57.4 bits (137), Expect = 2e-08
Identities = 34/158 (21%), Positives = 68/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W+++
Sbjct: 99 ADYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWLCTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI----------------HRKQWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTIKIWNLGSPDPNFTLDAHLKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT + V+ HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLEGHTHNVSAVSFHPELPIIITGSEDGTVRIW 256



Score = 36.2 bits (82), Expect = 0.052
Identities = 17/69 (24%), Positives = 37/69 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 199 KPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVSFHPELPIIITGSEDGTVRIWHA 258

Query: 154 NTMDIIRTL 128
T + TL
Sbjct: 259 TTYRLENTL 267



Score = 29.3 bits (64), Expect = 6.4
Identities = 20/73 (27%), Positives = 32/73 (43%)
Frame = -2

Query: 382 LAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQ 203
L + V +V HP P I+T G+V IW+ + L + V + I +
Sbjct: 225 LEGHTHNVSAVSFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGHIKGSR 284

Query: 202 WIVAGADDMNIRV 164
+V G D+ +I V
Sbjct: 285 RVVIGYDEGSIMV 297


>sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis
thaliana GN=At3g15980 PE=2 SV=1
Length = 909

Score = 238 bits (608), Expect = 5e-63
Identities = 109/132 (82%), Positives = 121/132 (91%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRK AQRS+RVKSVDLHPTEPWIL SLY+G+V IWNYQ+Q++ KSFEVTELPVRSAKF
Sbjct: 6 DIKRKFAQRSERVKSVDLHPTEPWILASLYSGTVCIWNYQTQTITKSFEVTELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD ++ EAH+DYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 IPRKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDW+ GW CTQI
Sbjct: 126 WDWENGWACTQI 137



Score = 57.8 bits (138), Expect = 2e-08
Identities = 35/158 (22%), Positives = 69/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
SD ++ V +HPT P++L+S + +W+++
Sbjct: 99 SDYIRCVAVHPTLPYVLSSSDDMLIKLWDWENGWACTQIFEGHSHYVMQVVFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TL+ HT + V HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIW 256



Score = 33.9 bits (76), Expect = 0.26
Identities = 16/69 (23%), Positives = 37/69 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P+++T + +W+YQ++S V++ + V + F I+ G++D +R+++
Sbjct: 199 KPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWHA 258

Query: 154 NTMDIIRTL 128
T + TL
Sbjct: 259 TTYRLENTL 267



Score = 29.3 bits (64), Expect = 6.4
Identities = 11/40 (27%), Positives = 24/40 (60%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
+DI R ++ ++ V +HPT P++L+S + +W++
Sbjct: 5 LDIKRKFAQRSERVKSVDLHPTEPWILASLYSGTVCIWNY 44



Score = 29.3 bits (64), Expect = 6.4
Identities = 19/66 (28%), Positives = 30/66 (45%)
Frame = -2

Query: 361 VKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGAD 182
V +V HP P I+T G+V IW+ + L + V + +I + +V G D
Sbjct: 232 VSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYD 291

Query: 181 DMNIRV 164
+ I V
Sbjct: 292 EGTIMV 297


>sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii
GN=COPB2 PE=2 SV=1
Length = 906

Score = 215 bits (547), Expect = 6e-56
Identities = 92/132 (69%), Positives = 116/132 (87%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRKL RSDRVKSVDLHPTEPW+L SLY GSV +WN+++Q+LVK+FEV +LPVR+AKF
Sbjct: 6 DIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RK W+V GADDM IRV+NYNT++ + EAH+DYIRC+AVHPT P++L+SSDDMLIKL
Sbjct: 66 VARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDK W+C+Q+
Sbjct: 126 WDWDKKWSCSQV 137



Score = 64.3 bits (155), Expect = 2e-10
Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
SD ++ + +HPT+P+ILTS + +W++
Sbjct: 99 SDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFIHR----------------KQWIVAGADDMNIRVYNYNT 149
S SL ++ +V +L S F K ++++GADD +++++Y
Sbjct: 159 ASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQN 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + C + HP LP +++ S+D +++W
Sbjct: 219 KTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIW 256



Score = 40.4 bits (93), Expect = 0.003
Identities = 21/80 (26%), Positives = 43/80 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P++++ V IW+YQ+++ V++ E V A F I+ G++D +R+++
Sbjct: 199 KPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHS 258

Query: 154 NTMDIIRTLEAHTDYIRCVA 95
+T + TL + + CVA
Sbjct: 259 STYRLESTLNYGMERVWCVA 278



Score = 32.3 bits (72), Expect = 0.75
Identities = 14/39 (35%), Positives = 26/39 (66%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 32
+DI R L A +D ++ V +HPT P++L+S + + +W+
Sbjct: 5 LDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWN 43


>sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus
GN=Copb2 PE=2 SV=2
Length = 905

Score = 215 bits (547), Expect = 6e-56
Identities = 92/132 (69%), Positives = 116/132 (87%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRKL RSDRVKSVDLHPTEPW+L SLY GSV +WN+++Q+LVK+FEV +LPVR+AKF
Sbjct: 6 DIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RK W+V GADDM IRV+NYNT++ + EAH+DYIRC+AVHPT P++L+SSDDMLIKL
Sbjct: 66 VARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDK W+C+Q+
Sbjct: 126 WDWDKKWSCSQV 137



Score = 64.3 bits (155), Expect = 2e-10
Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
SD ++ + +HPT+P+ILTS + +W++
Sbjct: 99 SDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFIHR----------------KQWIVAGADDMNIRVYNYNT 149
S SL ++ +V +L S F K ++++GADD +++++Y
Sbjct: 159 ASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQN 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + C + HP LP +++ S+D +++W
Sbjct: 219 KTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIW 256



Score = 40.4 bits (93), Expect = 0.003
Identities = 21/80 (26%), Positives = 43/80 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P++++ V IW+YQ+++ V++ E V A F I+ G++D +R+++
Sbjct: 199 KPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHS 258

Query: 154 NTMDIIRTLEAHTDYIRCVA 95
+T + TL + + CVA
Sbjct: 259 STYRLESTLNYGMERVWCVA 278



Score = 32.3 bits (72), Expect = 0.75
Identities = 14/39 (35%), Positives = 26/39 (66%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 32
+DI R L A +D ++ V +HPT P++L+S + + +W+
Sbjct: 5 LDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWN 43


>sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis
GN=COPB2 PE=2 SV=1
Length = 906

Score = 215 bits (547), Expect = 6e-56
Identities = 92/132 (69%), Positives = 116/132 (87%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRKL RSDRVKSVDLHPTEPW+L SLY GSV +WN+++Q+LVK+FEV +LPVR+AKF
Sbjct: 6 DIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RK W+V GADDM IRV+NYNT++ + EAH+DYIRC+AVHPT P++L+SSDDMLIKL
Sbjct: 66 VARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDK W+C+Q+
Sbjct: 126 WDWDKKWSCSQV 137



Score = 64.3 bits (155), Expect = 2e-10
Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
SD ++ + +HPT+P+ILTS + +W++
Sbjct: 99 SDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFIHR----------------KQWIVAGADDMNIRVYNYNT 149
S SL ++ +V +L S F K ++++GADD +++++Y
Sbjct: 159 ASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQN 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + C + HP LP +++ S+D +++W
Sbjct: 219 KTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIW 256



Score = 40.4 bits (93), Expect = 0.003
Identities = 21/80 (26%), Positives = 43/80 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P++++ V IW+YQ+++ V++ E V A F I+ G++D +R+++
Sbjct: 199 KPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHS 258

Query: 154 NTMDIIRTLEAHTDYIRCVA 95
+T + TL + + CVA
Sbjct: 259 STYRLESTLNYGMERVWCVA 278



Score = 32.3 bits (72), Expect = 0.75
Identities = 14/39 (35%), Positives = 26/39 (66%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 32
+DI R L A +D ++ V +HPT P++L+S + + +W+
Sbjct: 5 LDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWN 43


>sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens
GN=COPB2 PE=1 SV=2
Length = 906

Score = 215 bits (547), Expect = 6e-56
Identities = 92/132 (69%), Positives = 116/132 (87%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
+IKRKL RSDRVKSVDLHPTEPW+L SLY GSV +WN+++Q+LVK+FEV +LPVR+AKF
Sbjct: 6 DIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RK W+V GADDM IRV+NYNT++ + EAH+DYIRC+AVHPT P++L+SSDDMLIKL
Sbjct: 66 VARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDK W+C+Q+
Sbjct: 126 WDWDKKWSCSQV 137



Score = 64.3 bits (155), Expect = 2e-10
Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
SD ++ + +HPT+P+ILTS + +W++
Sbjct: 99 SDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFIHR----------------KQWIVAGADDMNIRVYNYNT 149
S SL ++ +V +L S F K ++++GADD +++++Y
Sbjct: 159 ASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQN 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + C + HP LP +++ S+D +++W
Sbjct: 219 KTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIW 256



Score = 40.4 bits (93), Expect = 0.003
Identities = 21/80 (26%), Positives = 43/80 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P++++ V IW+YQ+++ V++ E V A F I+ G++D +R+++
Sbjct: 199 KPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHS 258

Query: 154 NTMDIIRTLEAHTDYIRCVA 95
+T + TL + + CVA
Sbjct: 259 STYRLESTLNYGMERVWCVA 278



Score = 32.3 bits (72), Expect = 0.75
Identities = 14/39 (35%), Positives = 26/39 (66%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 32
+DI R L A +D ++ V +HPT P++L+S + + +W+
Sbjct: 5 LDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWN 43


tr_hit_id A1YKF7
Definition tr|A1YKF7|A1YKF7_BRASY Coatomer complex subunit OS=Brachypodium sylvaticum
Align length 132
Score (bit) 245.0
E-value 9.0e-64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913304|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_G08.
(398 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A1YKF7|A1YKF7_BRASY Coatomer complex subunit OS=Brachypodium ... 245 9e-64
tr|B4FIP7|B4FIP7_MAIZE Putative uncharacterized protein OS=Zea m... 244 2e-63
tr|A7P7E9|A7P7E9_VITVI Chromosome chr9 scaffold_7, whole genome ... 244 2e-63
tr|A9SAN0|A9SAN0_PHYPA Predicted protein OS=Physcomitrella paten... 242 8e-63
tr|B8AE85|B8AE85_ORYSI Putative uncharacterized protein OS=Oryza... 240 2e-62
tr|B3H5V5|B3H5V5_ARATH Uncharacterized protein At1g79990.2 OS=Ar... 240 3e-62
tr|A5AWP2|A5AWP2_VITVI Putative uncharacterized protein OS=Vitis... 238 8e-62
tr|B8ADW8|B8ADW8_ORYSI Putative uncharacterized protein OS=Oryza... 238 1e-61
tr|A9SHI8|A9SHI8_PHYPA Predicted protein OS=Physcomitrella paten... 237 2e-61
tr|Q45NL8|Q45NL8_MEDSA Coatomer protein complex subunit beta 2 (... 236 3e-61
tr|A7PES4|A7PES4_VITVI Chromosome chr11 scaffold_13, whole genom... 236 4e-61
tr|A9TJC1|A9TJC1_PHYPA Predicted protein OS=Physcomitrella paten... 235 9e-61
tr|A3A4F1|A3A4F1_ORYSJ Putative uncharacterized protein OS=Oryza... 233 3e-60
tr|A3A4F0|A3A4F0_ORYSJ Putative uncharacterized protein OS=Oryza... 228 9e-59
tr|A8JGS8|A8JGS8_CHLRE Beta'-cop OS=Chlamydomonas reinhardtii GN... 224 1e-57
tr|Q4VA86|Q4VA86_XENTR Putative uncharacterized protein mgc10808... 215 1e-54
tr|Q5M7X1|Q5M7X1_RAT Coatomer protein complex, subunit beta 2 (B... 215 1e-54
tr|B4E2C9|B4E2C9_HUMAN cDNA FLJ61545, highly similar to Coatomer... 215 1e-54
tr|Q7ZTR0|Q7ZTR0_XENLA Wu:fc55e05-prov protein OS=Xenopus laevis... 214 1e-54
tr|Q6JWU7|Q6JWU7_DANRE Coatomer protein complex subunit beta 2 O... 212 8e-54
tr|Q2HYN2|Q2HYN2_ICTPU Putative uncharacterized protein (Fragmen... 212 8e-54
tr|B3DH83|B3DH83_DANRE Coatomer protein complex, subunit beta 2 ... 212 8e-54
tr|B0R171|B0R171_DANRE Coatomer protein complex, subunit beta 2 ... 212 8e-54
tr|A7RL77|A7RL77_NEMVE Predicted protein OS=Nematostella vectens... 210 2e-53
tr|A7QH73|A7QH73_VITVI Chromosome chr18 scaffold_96, whole genom... 205 1e-51
tr|A5AP90|A5AP90_VITVI Putative uncharacterized protein OS=Vitis... 204 2e-51
tr|A4RR16|A4RR16_OSTLU Predicted protein OS=Ostreococcus lucimar... 204 2e-51
tr|A7QH71|A7QH71_VITVI Chromosome chr18 scaffold_96, whole genom... 203 3e-51
tr|B6LX76|B6LX76_BRAFL Putative uncharacterized protein OS=Branc... 203 4e-51
tr|B7QCB7|B7QCB7_IXOSC Vesicle coat complex COPI, beta' subunit,... 202 7e-51

>tr|A1YKF7|A1YKF7_BRASY Coatomer complex subunit OS=Brachypodium
sylvaticum GN=57h21.22 PE=4 SV=1
Length = 911

Score = 245 bits (625), Expect = 9e-64
Identities = 113/132 (85%), Positives = 124/132 (93%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRK AQRS+RVKSVDLHPTEPWIL+SLY+GSV IW+YQSQ++VKSFEV+ELPVRSAKF
Sbjct: 6 EIKRKFAQRSERVKSVDLHPTEPWILSSLYSGSVCIWDYQSQTMVKSFEVSELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RKQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 VSRKQWVVAGADDMYIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDKGW CTQI
Sbjct: 126 WDWDKGWMCTQI 137



Score = 57.0 bits (136), Expect = 5e-07
Identities = 36/158 (22%), Positives = 68/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W++
Sbjct: 99 TDYIRCVAVHPTLPYVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTTKIWSLGSPDPNFTLDGHQKGVNCVDYFTGGDRPYLITGSDDSTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT I V HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIW 256



Score = 35.0 bits (79), Expect = 1.9
Identities = 16/68 (23%), Positives = 36/68 (52%)
Frame = -2

Query: 331 PWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNYN 152
P+++T + +W+YQ++S V++ E + + F I+ G++D +R+++
Sbjct: 200 PYLITGSDDSTAKVWDYQTKSCVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIWHST 259

Query: 151 TMDIIRTL 128
T + TL
Sbjct: 260 TYRLENTL 267


>tr|B4FIP7|B4FIP7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 343

Score = 244 bits (622), Expect = 2e-63
Identities = 113/132 (85%), Positives = 124/132 (93%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRK AQRS+RVKSVDLHPTEPWIL+SLY+GSV IW+YQ+Q++VKSFEV+ELPVRSAKF
Sbjct: 6 EIKRKFAQRSERVKSVDLHPTEPWILSSLYSGSVCIWDYQAQAMVKSFEVSELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 ISRKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDKGW CTQI
Sbjct: 126 WDWDKGWMCTQI 137



Score = 57.0 bits (136), Expect = 5e-07
Identities = 36/158 (22%), Positives = 68/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W++
Sbjct: 99 TDYIRCVAVHPTLPYVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDINTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTTKIWSLGSPDPNFTLDGHQKGVNCVDYFTGGDRPYLITGSDDSTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT I V HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIW 256



Score = 35.0 bits (79), Expect = 1.9
Identities = 16/68 (23%), Positives = 36/68 (52%)
Frame = -2

Query: 331 PWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNYN 152
P+++T + +W+YQ++S V++ E + + F I+ G++D +R+++
Sbjct: 200 PYLITGSDDSTAKVWDYQTKSCVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIWHST 259

Query: 151 TMDIIRTL 128
T + TL
Sbjct: 260 TYRLENTL 267


>tr|A7P7E9|A7P7E9_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034434001
PE=4 SV=1
Length = 1017

Score = 244 bits (622), Expect = 2e-63
Identities = 113/132 (85%), Positives = 123/132 (93%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRKLAQRS+RVKSVDLHP+EPWIL SLY+G+V IWNYQSQ++ KSFEVTELPVRSAKF
Sbjct: 63 EIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKF 122

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 123 IARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 182

Query: 37 WDWDKGWTCTQI 2
WDW+KGW CTQI
Sbjct: 183 WDWEKGWVCTQI 194



Score = 57.8 bits (138), Expect = 3e-07
Identities = 35/158 (22%), Positives = 69/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W+++
Sbjct: 156 TDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWVCTQIFEGHSHYVMQVTFNPKDTNTF 215

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 216 ASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQT 275

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT + V HP LP +++ S+D +++W
Sbjct: 276 KSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIW 313



Score = 38.5 bits (88), Expect = 0.17
Identities = 16/66 (24%), Positives = 40/66 (60%), Gaps = 6/66 (9%)
Frame = -2

Query: 208 KQWIVAGADDMNIRVYNYNT------MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDML 47
K ++++G+DD +V++Y + ++I R L ++ ++ V +HP+ P++L+S
Sbjct: 36 KPYLISGSDDHTAKVWDYQSKSCPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGT 95

Query: 46 IKLWDW 29
+ +W++
Sbjct: 96 VCIWNY 101



Score = 35.0 bits (79), Expect = 1.9
Identities = 17/69 (24%), Positives = 37/69 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 256 KPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHA 315

Query: 154 NTMDIIRTL 128
T + TL
Sbjct: 316 TTYRLENTL 324


>tr|A9SAN0|A9SAN0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_210315 PE=4 SV=1
Length = 909

Score = 242 bits (617), Expect = 8e-63
Identities = 114/132 (86%), Positives = 122/132 (92%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRKLAQRSDRVK VD+HPTEPWIL +LYTGSV IWN+Q+Q+LVKSFEVTELPVRSAKF
Sbjct: 6 EIKRKLAQRSDRVKCVDIHPTEPWILAALYTGSVCIWNHQNQTLVKSFEVTELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQWIV GADDM IRVYNYNTMD ++ EAH+DYIR VAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 IFRKQWIVTGADDMFIRVYNYNTMDKVKQFEAHSDYIRSVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDWDKGWTCTQI
Sbjct: 126 WDWDKGWTCTQI 137



Score = 63.5 bits (153), Expect = 5e-09
Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 46/164 (28%)
Frame = -2

Query: 388 RKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------- 278
++ SD ++SV +HPT P++L+S + +W++
Sbjct: 93 KQFEAHSDYIRSVAVHPTLPYVLSSSDDMLIKLWDWDKGWTCTQIFEGHSHYVMQVTINP 152

Query: 277 -------SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIR 167
S SL ++ ++ L F H+K +++ G+DD +
Sbjct: 153 KDNNTFASASLDRTIKIWNLGSPEPNFTLEAHQKGVNCVEYFSGGDRPYLITGSDDQTAK 212

Query: 166 VYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
V++Y T ++TLE HT + VA HP LP +L+ S+D +++W
Sbjct: 213 VWDYQTKSCVQTLEGHTHNVSAVAFHPDLPIILTGSEDGYVRIW 256



Score = 33.1 bits (74), Expect = 7.0
Identities = 17/68 (25%), Positives = 36/68 (52%)
Frame = -2

Query: 331 PWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNYN 152
P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 200 PYLITGSDDQTAKVWDYQTKSCVQTLEGHTHNVSAVAFHPDLPIILTGSEDGYVRIWHST 259

Query: 151 TMDIIRTL 128
T + TL
Sbjct: 260 TYRLENTL 267



Score = 32.7 bits (73), Expect = 9.2
Identities = 12/39 (30%), Positives = 25/39 (64%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 32
++I R L +D ++CV +HPT P++L++ + +W+
Sbjct: 5 LEIKRKLAQRSDRVKCVDIHPTEPWILAALYTGSVCIWN 43


>tr|B8AE85|B8AE85_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06330 PE=4 SV=1
Length = 922

Score = 240 bits (613), Expect = 2e-62
Identities = 112/130 (86%), Positives = 122/130 (93%)
Frame = -2

Query: 391 KRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIH 212
KRKLAQRS+RVKSVDLHPTEPWIL+SLY+GSV IWNYQ+Q++VKSFEVTELPVRS+KFI
Sbjct: 105 KRKLAQRSERVKSVDLHPTEPWILSSLYSGSVCIWNYQTQTMVKSFEVTELPVRSSKFIA 164

Query: 211 RKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 32
RKQWIVAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPT P+VLSSSDDMLIKLWD
Sbjct: 165 RKQWIVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTQPFVLSSSDDMLIKLWD 224

Query: 31 WDKGWTCTQI 2
WDKGW CTQI
Sbjct: 225 WDKGWMCTQI 234



Score = 57.0 bits (136), Expect = 5e-07
Identities = 37/158 (23%), Positives = 66/158 (41%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT+P++L+S + +W++
Sbjct: 196 TDYIRCVAVHPTQPFVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDTNTF 255

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ +V L F H K +++ G+DD +V++Y T
Sbjct: 256 ASASLDRTVKVWSLGSPDPNFTLDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQT 315

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + V HP LP L+ S+D ++LW
Sbjct: 316 KSCVQTLEGHAHNVSAVCFHPELPITLTGSEDGTVRLW 353


>tr|B3H5V5|B3H5V5_ARATH Uncharacterized protein At1g79990.2
OS=Arabidopsis thaliana GN=At1g79990 PE=4 SV=1
Length = 912

Score = 240 bits (612), Expect = 3e-62
Identities = 111/132 (84%), Positives = 122/132 (92%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRK AQRS+RVKSVDLHPTEPWIL SLY+G++ IWNYQ+Q++VKSF+VTELPVRSAKF
Sbjct: 6 EIKRKFAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQTMVKSFDVTELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
I RKQW+VAGADDM IRVYNYNTMD I+ EAH DYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 IARKQWVVAGADDMFIRVYNYNTMDKIKVFEAHADYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCTQI 2
WDW+KGW CTQI
Sbjct: 126 WDWEKGWLCTQI 137



Score = 57.4 bits (137), Expect = 3e-07
Identities = 34/158 (21%), Positives = 68/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W+++
Sbjct: 99 ADYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWLCTQIFEGHSHYVMQVTFNPKDTNTF 158

Query: 277 -SQSLVKSFEVTELPVRSAKFI----------------HRKQWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F K +++ G+DD +V++Y T
Sbjct: 159 ASASLDRTIKIWNLGSPDPNFTLDAHLKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQT 218

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT + V+ HP LP +++ S+D +++W
Sbjct: 219 KSCVQTLEGHTHNVSAVSFHPELPIIITGSEDGTVRIW 256



Score = 36.2 bits (82), Expect = 0.83
Identities = 17/69 (24%), Positives = 37/69 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 199 KPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVSFHPELPIIITGSEDGTVRIWHA 258

Query: 154 NTMDIIRTL 128
T + TL
Sbjct: 259 TTYRLENTL 267


>tr|A5AWP2|A5AWP2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004513 PE=4 SV=1
Length = 901

Score = 238 bits (608), Expect = 8e-62
Identities = 110/129 (85%), Positives = 120/129 (93%)
Frame = -2

Query: 388 RKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHR 209
RKLAQRS+RVKSVDLHP+EPWIL SLY+G+V IWNYQSQ++ KSFEVTELPVRSAKFI R
Sbjct: 2 RKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFIAR 61

Query: 208 KQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
KQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW
Sbjct: 62 KQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 121

Query: 28 DKGWTCTQI 2
+KGW CTQI
Sbjct: 122 EKGWVCTQI 130



Score = 57.8 bits (138), Expect = 3e-07
Identities = 35/158 (22%), Positives = 69/158 (43%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT P++L+S + +W+++
Sbjct: 92 TDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWVCTQIFDGHSHYVMQVTFNPKDTNTF 151

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ ++ L F H+K +++ G+DD +V++Y T
Sbjct: 152 ASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQT 211

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE HT + V HP LP +++ S+D +++W
Sbjct: 212 KSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIW 249



Score = 35.0 bits (79), Expect = 1.9
Identities = 17/69 (24%), Positives = 37/69 (53%)
Frame = -2

Query: 334 EPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNY 155
+P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 192 KPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHA 251

Query: 154 NTMDIIRTL 128
T + TL
Sbjct: 252 TTYRLENTL 260


>tr|B8ADW8|B8ADW8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06329 PE=4 SV=1
Length = 897

Score = 238 bits (607), Expect = 1e-61
Identities = 110/129 (85%), Positives = 121/129 (93%)
Frame = -2

Query: 388 RKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHR 209
RKLAQRS+RVKSVDLHPTEPWIL+SLY+GSV IWNYQ+Q++VKSFEVTELPVRS+KFI R
Sbjct: 2 RKLAQRSERVKSVDLHPTEPWILSSLYSGSVCIWNYQTQTMVKSFEVTELPVRSSKFIAR 61

Query: 208 KQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
KQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPT P+VLSSSDDMLIKLWDW
Sbjct: 62 KQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTQPFVLSSSDDMLIKLWDW 121

Query: 28 DKGWTCTQI 2
DKGW CTQI
Sbjct: 122 DKGWMCTQI 130



Score = 58.2 bits (139), Expect = 2e-07
Identities = 37/158 (23%), Positives = 67/158 (42%), Gaps = 46/158 (29%)
Frame = -2

Query: 370 SDRVKSVDLHPTEPWILTSLYTGSVYIWNYQ----------------------------- 278
+D ++ V +HPT+P++L+S + +W++
Sbjct: 92 TDYIRCVAVHPTQPFVLSSSDDMLIKLWDWDKGWMCTQIFEGHSHYVMQVTFNPKDTNTF 151

Query: 277 -SQSLVKSFEVTELPVRSAKFI---HRK-------------QWIVAGADDMNIRVYNYNT 149
S SL ++ +V L F H K +++ G+DD +V++Y T
Sbjct: 152 ASASLDRTVKVWSLGSPDPNFTLDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQT 211

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++TLE H + V HP LP +L+ S+D ++LW
Sbjct: 212 KSCVQTLEGHAHNVSAVCFHPELPIILTGSEDGTVRLW 249



Score = 33.1 bits (74), Expect = 7.0
Identities = 17/68 (25%), Positives = 36/68 (52%)
Frame = -2

Query: 331 PWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFIHRKQWIVAGADDMNIRVYNYN 152
P+++T + +W+YQ++S V++ E V + F I+ G++D +R+++
Sbjct: 193 PYLITGSDDQTAKVWDYQTKSCVQTLEGHAHNVSAVCFHPELPIILTGSEDGTVRLWHST 252

Query: 151 TMDIIRTL 128
T + TL
Sbjct: 253 TYRLENTL 260


>tr|A9SHI8|A9SHI8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164902 PE=4 SV=1
Length = 992

Score = 237 bits (604), Expect = 2e-61
Identities = 110/131 (83%), Positives = 121/131 (92%)
Frame = -2

Query: 394 IKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKFI 215
IKRKLAQRS+RVK VDLHPTEPWIL+SLYTGS++IWNYQ+QSLVKSFEVT+LPVRSAKFI
Sbjct: 38 IKRKLAQRSERVKCVDLHPTEPWILSSLYTGSLHIWNYQNQSLVKSFEVTDLPVRSAKFI 97

Query: 214 HRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
RKQW+VA +DDM IRVYNYNTMD ++ EAHTDYIRCV VHPTLPYVLS SDDMLIKLW
Sbjct: 98 PRKQWVVACSDDMFIRVYNYNTMDKVKQFEAHTDYIRCVIVHPTLPYVLSCSDDMLIKLW 157

Query: 34 DWDKGWTCTQI 2
DW+KGW CTQI
Sbjct: 158 DWEKGWICTQI 168



Score = 43.9 bits (102), Expect = 0.004
Identities = 25/110 (22%), Positives = 47/110 (42%), Gaps = 21/110 (19%)
Frame = -2

Query: 301 SVYIWNYQSQSLVKSFEVTELPVRSAKFIHR--KQWIVAGADDMNIRV------------ 164
+V IWN S + E + V ++ + ++ G+DD +V
Sbjct: 197 TVKIWNLSSPEPNFTLEAHQKGVNCVEYFTGGDRPHLITGSDDQTAKVLGSLKAVSRFVV 256

Query: 163 -------YNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLW 35
++Y T ++TLE H+ + HP LP +L+ S+D +++W
Sbjct: 257 HFTRLTVWDYQTKGCVQTLEGHSHNVSAACFHPELPIILTGSEDGTVRIW 306



Score = 40.8 bits (94), Expect = 0.034
Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 4/121 (3%)
Frame = -2

Query: 388 RKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSL-VKSFEVTELPVRSAKFIH 212
++ +D ++ V +HPT P++L+ + +W+++ + + FE V F
Sbjct: 124 KQFEAHTDYIRCVIVHPTLPYVLSCSDDMLIKLWDWEKGWICTQIFEGHSHYVMQVTFNP 183

Query: 211 RKQWIVAGAD-DMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHP--TLPYVLSSSDDMLIK 41
+ A A D ++++N ++ + TLEAH + CV P++++ SDD K
Sbjct: 184 KDSNTFASASLDRTVKIWNLSSPEPNFTLEAHQKGVNCVEYFTGGDRPHLITGSDDQTAK 243

Query: 40 L 38
+
Sbjct: 244 V 244


>tr|Q45NL8|Q45NL8_MEDSA Coatomer protein complex subunit beta 2
(Fragment) OS=Medicago sativa PE=2 SV=1
Length = 135

Score = 236 bits (603), Expect = 3e-61
Identities = 109/130 (83%), Positives = 119/130 (91%)
Frame = -2

Query: 397 EIKRKLAQRSDRVKSVDLHPTEPWILTSLYTGSVYIWNYQSQSLVKSFEVTELPVRSAKF 218
EIKRKLAQRS+RVK V LHPTEPWIL SLY+G+V IWNYQSQ++ KSFEVTELPVRSAKF
Sbjct: 6 EIKRKLAQRSERVKCVGLHPTEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKF 65

Query: 217 IHRKQWIVAGADDMNIRVYNYNTMDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 38
+ RKQW+VAGADDM IRVYNYNTMD ++ EAHTDYIRCVAVHPTLPYVLSSSDDMLIKL
Sbjct: 66 VARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKL 125

Query: 37 WDWDKGWTCT 8
WDW+KGW CT
Sbjct: 126 WDWEKGWICT 135



Score = 33.9 bits (76), Expect = 4.1
Identities = 12/40 (30%), Positives = 26/40 (65%)
Frame = -2

Query: 148 MDIIRTLEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDW 29
++I R L ++ ++CV +HPT P++L+S + +W++
Sbjct: 5 LEIKRKLAQRSERVKCVGLHPTEPWILASLYSGTVCIWNY 44