BP913307
Clone id YMU001_000028_G11
Library
Length 593
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGAAAATACAAAATCCATCATATAAGCAGTCAAGTGGGACTTTGACATTGCATTTGAAA
AGTGATGTGCCCAAAACTGGCAGCATCTTTACTGGAGAAAGAGGGCCACCCTTATGAGTC
CAGCGATTGAAAGATGCCACCAGCCATACTTCAGGCTTTCCATTGAGCACTGTTTTAGAT
GGGTTATAAAAAACTTTCACTTCTTTGCCAGCCTGCACATCAACTGGATCTGTATAGAAT
ATGTGTTCACGGGACTTTACAAGTATACTTTTGGTCTTTTCCTTCAACTGTGCCTTGATC
TCGGCTGTACGTTCAGCCTTCTTGAGAGTAGCTTCCTCTCTTTACTCTCGTTCCTCTTGA
AGCATATTGAATATACAATCCTCTACCTCTTGCCAATGCAAATCATTAGGGACGCCTCTT
GGAACCAATGCATGAAAGTCCTGATATCCATTGTTATCATACAATGTAACAGCCTCCATA
GGTCCATCGGCAAGGACCCAATCGAGTACAAATGCCTGTTTAGGTACTTCAACATCTATT
GTCCATCAATCACCACCTTCAGCACTATGAAAAGTTAGTTTTCCCACCATTGA
■■Homology search results ■■ -
sp_hit_id Q43846
Definition sp|Q43846|SSY3_SOLTU Soluble starch synthase 3, chloroplastic/amyloplastic OS=Solanum tuberosum
Align length 188
Score (bit) 199.0
E-value 9.0e-52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913307|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_G11.
(593 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q43846|SSY3_SOLTU Soluble starch synthase 3, chloroplastic/am... 199 9e-52
sp|P03277|HEX_ADE02 Hexon protein OS=Human adenovirus C serotype... 35 0.22
sp|Q04080|GPI17_YEAST GPI transamidase component GPI17 OS=Saccha... 33 0.82
sp|Q04965|HEX_ADE01 Hexon protein (Fragment) OS=Human adenovirus... 33 1.1
sp|Q04966|HEX_ADE06 Hexon protein (Fragment) OS=Human adenovirus... 32 1.8
sp|P04133|HEX_ADE05 Hexon protein OS=Human adenovirus C serotype... 32 1.8
sp|Q3UZD5|PRDM6_MOUSE Putative histone-lysine N-methyltransferas... 31 4.1
sp|Q9NQX0|PRDM6_HUMAN Putative histone-lysine N-methyltransferas... 31 4.1
sp|A6QPM3|PRDM6_BOVIN Putative histone-lysine N-methyltransferas... 31 4.1
sp|A1A5R8|K1841_RAT Uncharacterized protein KIAA1841 homolog OS=... 31 4.1
sp|Q6NSI8|K1841_HUMAN Uncharacterized protein KIAA1841 OS=Homo s... 31 4.1
sp|O88277|FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus GN=F... 31 4.1
sp|Q9NJA9|MYSP_ANISI Paramyosin OS=Anisakis simplex GN=PARA PE=1... 31 5.3
sp|Q68FF0|K1841_MOUSE Uncharacterized protein KIAA1841 OS=Mus mu... 31 5.3
sp|Q6C2T8|DAM1_YARLI DASH complex subunit DAM1 OS=Yarrowia lipol... 30 7.0
sp|Q9BUF7|CRUM3_HUMAN Crumbs protein homolog 3 OS=Homo sapiens G... 30 7.0
sp|Q99P25|TXIP1_MOUSE Translin-associated factor X-interacting p... 30 9.1
sp|Q06340|ESC2_YEAST Protein ESC2 OS=Saccharomyces cerevisiae GN... 30 9.1

>sp|Q43846|SSY3_SOLTU Soluble starch synthase 3,
chloroplastic/amyloplastic OS=Solanum tuberosum GN=SS3
PE=1 SV=1
Length = 1230

Score = 199 bits (505), Expect(2) = 9e-52
Identities = 96/188 (51%), Positives = 121/188 (64%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+V KL GD W +V +P QA LDWV ADGP + YDNN QDFHA+VP
Sbjct: 554 SIVKKLVKSERIDGDWWYTEVVIPDQALFLDWVFADGPPKHAIAYDNNHRQDFHAIVPNH 613

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+P +L+W E E IF LQEER RE A K E+TA +K + KE+T + S++H+ Y
Sbjct: 614 IPEELYWVEEEHQIFKTLQEERRLREAAMRAKVEKTALLKTETKERTMKSFLLSQKHVVY 673

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P+D+QAG V V+YNP+ TVLNGKPE+W SFNRWTH+ GPL P KM P + +
Sbjct: 674 TEPLDIQAGSSVTVYYNPANTVLNGKPEIWFRCSFNRWTHRLGPLPPQKMSPAENGTHVR 733

Query: 53 CNVKVPLD 30
VKVPLD
Sbjct: 734 ATVKVPLD 741



Score = 24.6 bits (52), Expect(2) = 9e-52
Identities = 12/17 (70%), Positives = 12/17 (70%)
Frame = -2

Query: 52 AMSKSHLTAYMMDFVFS 2
A K L AYMMDFVFS
Sbjct: 734 ATVKVPLDAYMMDFVFS 750



Score = 65.1 bits (157), Expect = 3e-10
Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 20/178 (11%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPN--------DL 399
GD W+ + VPK+A+ D+V +G +YDNN DF V G+ +
Sbjct: 390 GDWWSCKIHVPKEAYRADFVFFNGQ----DVYDNNDGNDFSITVKGGMQIIDFENFLLEE 445

Query: 398 HWQEVEDCIFNMLQEERE*REEATLK--KAERTAEIKAQLKE---KTKSIL-------VK 255
W+E E + ER E+ ++ KAE A+ +AQ KE K K +L K
Sbjct: 446 KWREQEKLAKEQAERERLAEEQRRIEAEKAEIEAD-RAQAKEEAAKKKKVLRELMVKATK 504

Query: 254 SREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKML 81
+R+ +Y +P + + +V+++YN S L+ ++W+ +N W K G LS VK L
Sbjct: 505 TRDITWYIEPSEFKCEDKVRLYYNKSSGPLSHAKDLWIHGGYNNW--KDG-LSIVKKL 559


>sp|P03277|HEX_ADE02 Hexon protein OS=Human adenovirus C serotype 2
GN=PII PE=1 SV=3
Length = 968

Score = 35.4 bits (80), Expect = 0.22
Identities = 16/52 (30%), Positives = 29/52 (55%)
Frame = -1

Query: 437 FHALVPRGVPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLK 282
++AL P+G PN W++ ED + ++E E E+ ++ E+ A +A K
Sbjct: 121 YNALAPKGAPNSCEWEQTEDSGRAVAEDEEEEDEDEEEEEEEQNARDQATKK 172


>sp|Q04080|GPI17_YEAST GPI transamidase component GPI17
OS=Saccharomyces cerevisiae GN=GPI17 PE=1 SV=1
Length = 534

Score = 33.5 bits (75), Expect = 0.82
Identities = 34/134 (25%), Positives = 58/134 (43%), Gaps = 11/134 (8%)
Frame = -1

Query: 482 PMEAVTLYDNNGYQDFHALVPRGVPNDLH-WQEVEDCI---FNMLQEERE*REEATLKKA 315
P+ + NN +QD H ++P V +D + + +V D I N L +E R +L+
Sbjct: 38 PINYIESLQNNKFQDIHLVIPVYVKSDTYRFPDVHDAIQVQVNHLLNSQEQRVPWSLQVL 97

Query: 314 ERTAEIKAQLKEKTK--SILVKSREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKP---- 153
I+ E + + +K E I Y+ D KE V+Y+ + + N P
Sbjct: 98 PYNETIEQMESEGNQFHVVTLKLDEFIGYSSAYDT---KETLVYYDDAAVLSNDLPFFVA 154

Query: 152 EVWLVASFN-RWTH 114
+ + +F WTH
Sbjct: 155 QTLVEHTFQLEWTH 168


>sp|Q04965|HEX_ADE01 Hexon protein (Fragment) OS=Human adenovirus C
serotype 1 GN=PII PE=3 SV=1
Length = 467

Score = 33.1 bits (74), Expect = 1.1
Identities = 24/80 (30%), Positives = 40/80 (50%)
Frame = -1

Query: 437 FHALVPRGVPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILV 258
++AL P+G PN W++ E + E E EEA ++AE AE Q +K K
Sbjct: 2 YNALAPKGAPNSCEWEQEEPT--QEMAGELEDEEEAEEEEAEEEAE-APQAGQKVK---- 54

Query: 257 KSREHIFYTDPVDVQAGKEV 198
+ H++ P+ AG+++
Sbjct: 55 --KTHVYAQAPL---AGEKI 69


>sp|Q04966|HEX_ADE06 Hexon protein (Fragment) OS=Human adenovirus C
serotype 6 GN=PII PE=3 SV=1
Length = 465

Score = 32.3 bits (72), Expect = 1.8
Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 3/83 (3%)
Frame = -1

Query: 437 FHALVPRGVPNDLHWQEVEDCIFNM--LQEERE*REEATLKKAERTAEIKAQLKEKTKSI 264
++AL P+G PN W++ E + L EE EA ++ E+ + + I
Sbjct: 2 YNALAPKGAPNSCEWEQNETAQVDAQELDEEENEANEAQAREQEQAKKTHVYAQAPLSGI 61

Query: 263 -LVKSREHIFYTDPVDVQAGKEV 198
+ K I D AGKE+
Sbjct: 62 KITKEGLQIGTADATVAGAGKEI 84


>sp|P04133|HEX_ADE05 Hexon protein OS=Human adenovirus C serotype 5
GN=PII PE=1 SV=3
Length = 952

Score = 32.3 bits (72), Expect = 1.8
Identities = 14/43 (32%), Positives = 24/43 (55%)
Frame = -1

Query: 437 FHALVPRGVPNDLHWQEVEDCIFNMLQEERE*REEATLKKAER 309
++AL P+G PN W E + L+EE + E+ ++AE+
Sbjct: 121 YNALAPKGAPNPCEWDEAATALEINLEEEDDDNEDEVDEQAEQ 163


>sp|Q3UZD5|PRDM6_MOUSE Putative histone-lysine N-methyltransferase
PRDM6 OS=Mus musculus GN=Prdm6 PE=1 SV=1
Length = 596

Score = 31.2 bits (69), Expect = 4.1
Identities = 15/37 (40%), Positives = 22/37 (59%)
Frame = -1

Query: 263 LVKSREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKP 153
+V+ R +IFY +D+ G E+ V+YN S T G P
Sbjct: 340 VVQYRSNIFYRACIDIPRGTELLVWYNDSYTSFFGIP 376


>sp|Q9NQX0|PRDM6_HUMAN Putative histone-lysine N-methyltransferase
PRDM6 OS=Homo sapiens GN=PRDM6 PE=2 SV=2
Length = 595

Score = 31.2 bits (69), Expect = 4.1
Identities = 15/37 (40%), Positives = 22/37 (59%)
Frame = -1

Query: 263 LVKSREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKP 153
+V+ R +IFY +D+ G E+ V+YN S T G P
Sbjct: 339 VVQYRSNIFYRACIDIPRGTELLVWYNDSYTSFFGIP 375


>sp|A6QPM3|PRDM6_BOVIN Putative histone-lysine N-methyltransferase
PRDM6 OS=Bos taurus GN=PRDM6 PE=2 SV=1
Length = 590

Score = 31.2 bits (69), Expect = 4.1
Identities = 15/37 (40%), Positives = 22/37 (59%)
Frame = -1

Query: 263 LVKSREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKP 153
+V+ R +IFY +D+ G E+ V+YN S T G P
Sbjct: 334 VVQYRSNIFYRACIDIPRGTELLVWYNDSYTSFFGIP 370


>sp|A1A5R8|K1841_RAT Uncharacterized protein KIAA1841 homolog
OS=Rattus norvegicus PE=2 SV=1
Length = 737

Score = 31.2 bits (69), Expect = 4.1
Identities = 10/34 (29%), Positives = 18/34 (52%)
Frame = +3

Query: 72 QNWQHLYWRKRATLMSPAIERCHQPYFRLSIEHC 173
++W+ +YWR T+ RC+Q + + HC
Sbjct: 381 KSWRDVYWRLWGTINWLTCSRCYQAFLCIEFSHC 414


tr_hit_id A7QZP6
Definition tr|A7QZP6|A7QZP6_VITVI Chromosome chr10 scaffold_282, whole genome shotgun sequence OS=Vitis vinifera
Align length 188
Score (bit) 209.0
E-value 8.0e-54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913307|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_G11.
(593 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QZP6|A7QZP6_VITVI Chromosome chr10 scaffold_282, whole geno... 209 8e-54
tr|Q9XGC0|Q9XGC0_VIGUN Starch synthase isoform SS III OS=Vigna u... 206 8e-53
tr|Q8W1P1|Q8W1P1_ORYSA Putative starch synthase III OS=Oryza sat... 198 3e-50
tr|Q0J9Z0|Q0J9Z0_ORYSJ Os04g0624600 protein OS=Oryza sativa subs... 198 3e-50
tr|Q7XPQ4|Q7XPQ4_ORYSJ OSJNBa0053K19.19 protein (Putative unchar... 198 3e-50
tr|B8AUJ2|B8AUJ2_ORYSI Putative uncharacterized protein OS=Oryza... 198 3e-50
tr|A4F2M4|A4F2M4_PHAVU Starch synthase III OS=Phaseolus vulgaris... 199 4e-50
tr|Q01KB6|Q01KB6_ORYSA H0215F08.14 protein OS=Oryza sativa GN=H0... 196 8e-50
tr|A4ZVI0|A4ZVI0_MAIZE Starch synthase IIIb-1 OS=Zea mays PE=2 SV=1 196 1e-49
tr|B2Z9Y2|B2Z9Y2_SORBI Starch synthase IIIb OS=Sorghum bicolor P... 192 1e-48
tr|Q9SAA5|Q9SAA5_ARATH F25C20.13 protein (Chloroplast starch syn... 190 3e-48
tr|Q306T0|Q306T0_ARATH Soluble starch synthase III OS=Arabidopsi... 190 3e-48
tr|A4ZVI1|A4ZVI1_MAIZE Starch synthase IIIb-2 OS=Zea mays PE=2 SV=1 186 8e-47
tr|A3BQD5|A3BQD5_ORYSJ Putative uncharacterized protein OS=Oryza... 185 4e-46
tr|Q6Z1D6|Q6Z1D6_ORYSJ Putative starch synthase DULL1 OS=Oryza s... 185 4e-46
tr|B8BBF7|B8BBF7_ORYSI Putative uncharacterized protein OS=Oryza... 185 5e-46
tr|O64923|O64923_MAIZE Starch synthase DULL1 OS=Zea mays GN=dull... 185 5e-46
tr|Q8L8G9|Q8L8G9_ORYSI Putative soluble starch synthase III-2 OS... 185 5e-46
tr|B0FLF0|B0FLF0_WHEAT Starch synthase IIIb OS=Triticum aestivum... 176 1e-43
tr|Q1L5W1|Q1L5W1_NICLS Starch synthase isoform 3 (Fragment) OS=N... 172 9e-43
tr|B2Z9Y1|B2Z9Y1_SORBI Starch synthase IIIa OS=Sorghum bicolor P... 174 3e-42
tr|Q9LKW5|Q9LKW5_AEGTA Starch synthase III OS=Aegilops tauschii ... 167 1e-40
tr|Q9LKW6|Q9LKW6_WHEAT Starch synthase III OS=Triticum aestivum ... 162 4e-39
tr|A4S8C2|A4S8C2_OSTLU Predicted protein OS=Ostreococcus lucimar... 100 1e-20
tr|Q00U94|Q00U94_OSTTA Soluble Starch synthase III (IC) OS=Ostre... 99 9e-20
tr|Q6PYY3|Q6PYY3_OSTTA SSIIIa (Fragment) OS=Ostreococcus tauri G... 99 9e-20
tr|Q00X58|Q00X58_OSTTA Soluble Starch synthase III-B (IC) OS=Ost... 91 6e-17
tr|Q6PYY2|Q6PYY2_OSTTA SSIIIb (Fragment) OS=Ostreococcus tauri G... 90 8e-17
tr|Q4U1D9|Q4U1D9_CHLRE Soluble starch synthase III OS=Chlamydomo... 86 2e-15
tr|A8J233|A8J233_CHLRE Soluble starch synthase III OS=Chlamydomo... 84 8e-15

>tr|A7QZP6|A7QZP6_VITVI Chromosome chr10 scaffold_282, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00010759001
PE=4 SV=1
Length = 1104

Score = 209 bits (532), Expect(2) = 8e-54
Identities = 103/188 (54%), Positives = 129/188 (68%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+VG L + GD W ++V VP++A VLDWV ADGP + +LYDNN +DFHA+VP+
Sbjct: 430 SIVGSLIKDEKKEGDWWYVEVVVPERALVLDWVFADGPPQRASLYDNNHREDFHAIVPQS 489

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ +L+W E E I+ LQEER REEA K ERTA +KA+ KE+T + + S++HI Y
Sbjct: 490 ISEELYWVEEEYQIYKKLQEERWLREEAIRAKVERTARMKAEAKERTLKMFLLSQKHIVY 549

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P+DVQAG V V YNP+ TVLNGK EVW SFNRWTH+ G L P KMLPV S K
Sbjct: 550 TEPLDVQAGSTVSVLYNPANTVLNGKSEVWFRCSFNRWTHRNGSLPPQKMLPVDNGSHLK 609

Query: 53 CNVKVPLD 30
VKVPLD
Sbjct: 610 ATVKVPLD 617



Score = 24.6 bits (52), Expect(2) = 8e-54
Identities = 12/17 (70%), Positives = 12/17 (70%)
Frame = -2

Query: 52 AMSKSHLTAYMMDFVFS 2
A K L AYMMDFVFS
Sbjct: 610 ATVKVPLDAYMMDFVFS 626



Score = 53.5 bits (127), Expect = 9e-06
Identities = 42/165 (25%), Positives = 79/165 (47%), Gaps = 20/165 (12%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDF--------HALVPRGVPNDL 399
GD W+ V +PK+A+ +D+V +G +YDNN +DF AL + +
Sbjct: 266 GDWWSCQVHIPKEAYKMDFVFFNG----TNVYDNNNQKDFCIPVHGGMDALAFEDILLEE 321

Query: 398 HWQEVEDCIFNMLQEERE*REEATL--KKAERTAEIKAQLKEKTK------SILVK---- 255
+E+E + ER+ E+ + +KA R A+ +AQ + +T+ L+K
Sbjct: 322 KRRELEKLAKEQAERERQAEEQRRIEAEKAAREAD-RAQARAETERRREMLQHLMKKGAV 380

Query: 254 SREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRW 120
S ++++ +P + + V+++YN S L ++W+ N W
Sbjct: 381 SVDNVWCIEPREFKGDDLVRLYYNRSSGPLAHANDIWIHGGHNNW 425



Score = 37.7 bits (86), Expect = 0.50
Identities = 27/106 (25%), Positives = 47/106 (44%)
Frame = -1

Query: 320 KAERTAEIKAQLKEKTKSILVKSREHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWL 141
K E A + Q+ E+ +FY V V+ ++++VF N S + L+ +P+V +
Sbjct: 185 KLEMEANLHKQVLEELAEENFSRGNKMFYYPQV-VKPDQDIEVFLNRSVSTLSNEPDVMI 243

Query: 140 VASFNRWTHKGGPLSPVKMLPVLGTSLFKCNVKVPLDCLYDGFCIF 3
+ +FN W K + K L + C V +P + F F
Sbjct: 244 MGAFNDWRWKSFTIQLNK--THLQGDWWSCQVHIPKEAYKMDFVFF 287


>tr|Q9XGC0|Q9XGC0_VIGUN Starch synthase isoform SS III OS=Vigna
unguiculata PE=2 SV=1
Length = 1147

Score = 206 bits (523), Expect(2) = 8e-53
Identities = 99/188 (52%), Positives = 127/188 (67%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
++V +L +GG W DV VP QA VLDWV ADGP + +YDNN QDFHA+VP
Sbjct: 471 TIVERLVKSGLKGGAWWYADVVVPDQALVLDWVFADGPPQNAVVYDNNRMQDFHAIVPMA 530

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
P+ +W E E I+ LQEER+ +EE KAE+TA++KA+ KEKT + S++HI Y
Sbjct: 531 TPDAQYWVEEEQLIYRKLQEERKLKEEVIRAKAEKTAQMKAETKEKTLKKFLLSQKHIVY 590

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P+D+QAG V VFYNPS T LNG+PEVW SFNRW+H+ GPL P +MLP + K
Sbjct: 591 TEPLDIQAGSTVTVFYNPSNTNLNGRPEVWFRGSFNRWSHRNGPLPPQRMLPAESGTHVK 650

Query: 53 CNVKVPLD 30
+VKVPLD
Sbjct: 651 ASVKVPLD 658



Score = 24.6 bits (52), Expect(2) = 8e-53
Identities = 12/17 (70%), Positives = 12/17 (70%)
Frame = -2

Query: 52 AMSKSHLTAYMMDFVFS 2
A K L AYMMDFVFS
Sbjct: 651 ASVKVPLDAYMMDFVFS 667



Score = 54.3 bits (129), Expect = 5e-06
Identities = 38/163 (23%), Positives = 76/163 (46%), Gaps = 19/163 (11%)
Frame = -1

Query: 551 D*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDF--------HALVPRGVPNDLH 396
D W+ + VP++A+ +D+V +G ++YDNN +DF ALV +
Sbjct: 308 DWWSCQLYVPREAYKIDFVFFNGQ----SVYDNNDQKDFCIPVVGGMDALVFEDFLLEEK 363

Query: 395 WQEVEDCIFNMLQEERE*REEATLK-----KAERTAEIKAQLKEKTKSIL------VKSR 249
+E+E + ER+ E+ + K E + + ++++ ++L V S
Sbjct: 364 RKELEKLAKEQAERERQAEEQRRIDADKAVKGEDRLQARMEVEKMQDTLLQLMKNAVTSI 423

Query: 248 EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRW 120
++++Y +P + + V+++YN + L EVW+ N W
Sbjct: 424 DNVWYIEPSEFNSNDSVRLYYNGNSGPLQHAKEVWVHGGHNNW 466


>tr|Q8W1P1|Q8W1P1_ORYSA Putative starch synthase III OS=Oryza sativa
PE=4 SV=1
Length = 1216

Score = 198 bits (503), Expect(2) = 3e-50
Identities = 99/188 (52%), Positives = 124/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ KL + GD W DV +P+ A VLDWV ADGP YDNNG QDFHA+VP
Sbjct: 542 SIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVVPNN 601

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ DL W E E IF LQ+ER+ RE+A +K+E TA++KA++KEKT + S++HI Y
Sbjct: 602 ISEDLFWVEEEHMIFKRLQKERKEREDADRRKSEITAKMKAEMKEKTMRDFLLSQKHIVY 661

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGKPEVW SFNRWTH GPL P KM+ S +
Sbjct: 662 TEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHLR 721

Query: 53 CNVKVPLD 30
V+VPLD
Sbjct: 722 ATVRVPLD 729



Score = 23.9 bits (50), Expect(2) = 3e-50
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 728 LDAYMMDFVFS 738



Score = 68.2 bits (165), Expect = 3e-10
Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 24/170 (14%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPNDLHWQEVEDC 375
GD W + +PKQA+ LD+V +G T+Y+NN + DF + ++++ ED
Sbjct: 378 GDWWCCKLHIPKQAYRLDFVFFNGD----TIYENNNHNDFVLQIE----SEINEHSFEDF 429

Query: 374 IFNMLQ------------------EERE*REEATLKKAERTAEIKAQL---KEKTKSILV 258
+ Q EER EE +A+R A+ KA++ K K +++L
Sbjct: 430 LVEEKQRELERLAAEEAERKRQAEEERRKEEERAAMEADR-AQAKAEVEMNKNKLQNLLN 488

Query: 257 KSR---EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWT 117
+ ++++Y +P +AG VK+FYN S L E+W+ +N W+
Sbjct: 489 SASRYADNLWYIEPHTYKAGDRVKLFYNRSSRPLMHNTEIWMHGGYNNWS 538


>tr|Q0J9Z0|Q0J9Z0_ORYSJ Os04g0624600 protein OS=Oryza sativa subsp.
japonica GN=Os04g0624600 PE=4 SV=1
Length = 1216

Score = 198 bits (503), Expect(2) = 3e-50
Identities = 99/188 (52%), Positives = 124/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ KL + GD W DV +P+ A VLDWV ADGP YDNNG QDFHA+VP
Sbjct: 542 SIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVVPNN 601

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ DL W E E IF LQ+ER+ RE+A +K+E TA++KA++KEKT + S++HI Y
Sbjct: 602 ISEDLFWVEEEHMIFKRLQKERKEREDADRRKSEITAKMKAEMKEKTMRDFLLSQKHIVY 661

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGKPEVW SFNRWTH GPL P KM+ S +
Sbjct: 662 TEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHLR 721

Query: 53 CNVKVPLD 30
V+VPLD
Sbjct: 722 ATVRVPLD 729



Score = 23.9 bits (50), Expect(2) = 3e-50
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 728 LDAYMMDFVFS 738



Score = 68.2 bits (165), Expect = 3e-10
Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 24/170 (14%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPNDLHWQEVEDC 375
GD W + +PKQA+ LD+V +G T+Y+NN + DF + ++++ ED
Sbjct: 378 GDWWCCKLHIPKQAYRLDFVFFNGD----TIYENNNHNDFVLQIE----SEINEHSFEDF 429

Query: 374 IFNMLQ------------------EERE*REEATLKKAERTAEIKAQL---KEKTKSILV 258
+ Q EER EE +A+R A+ KA++ K K +++L
Sbjct: 430 LVEEKQRELERLAAEEAERKRQAEEERRKEEERAAMEADR-AQAKAEVEMNKNKLQNLLN 488

Query: 257 KSR---EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWT 117
+ ++++Y +P +AG VK+FYN S L E+W+ +N W+
Sbjct: 489 SASRYADNLWYIEPHTYKAGDRVKLFYNRSSRPLMHNTEIWMHGGYNNWS 538


>tr|Q7XPQ4|Q7XPQ4_ORYSJ OSJNBa0053K19.19 protein (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0053K19.19 PE=4 SV=2
Length = 1214

Score = 198 bits (503), Expect(2) = 3e-50
Identities = 99/188 (52%), Positives = 124/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ KL + GD W DV +P+ A VLDWV ADGP YDNNG QDFHA+VP
Sbjct: 540 SIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVVPNN 599

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ DL W E E IF LQ+ER+ RE+A +K+E TA++KA++KEKT + S++HI Y
Sbjct: 600 ISEDLFWVEEEHMIFKRLQKERKEREDADRRKSEITAKMKAEMKEKTMRDFLLSQKHIVY 659

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGKPEVW SFNRWTH GPL P KM+ S +
Sbjct: 660 TEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHLR 719

Query: 53 CNVKVPLD 30
V+VPLD
Sbjct: 720 ATVRVPLD 727



Score = 23.9 bits (50), Expect(2) = 3e-50
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 726 LDAYMMDFVFS 736



Score = 68.2 bits (165), Expect = 3e-10
Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 24/170 (14%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPNDLHWQEVEDC 375
GD W + +PKQA+ LD+V +G T+Y+NN + DF + ++++ ED
Sbjct: 376 GDWWCCKLHIPKQAYRLDFVFFNGD----TIYENNNHNDFVLQIE----SEINEHSFEDF 427

Query: 374 IFNMLQ------------------EERE*REEATLKKAERTAEIKAQL---KEKTKSILV 258
+ Q EER EE +A+R A+ KA++ K K +++L
Sbjct: 428 LVEEKQRELERLAAEEAERKRQAEEERRKEEERAAMEADR-AQAKAEVEMNKNKLQNLLN 486

Query: 257 KSR---EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWT 117
+ ++++Y +P +AG VK+FYN S L E+W+ +N W+
Sbjct: 487 SASRYADNLWYIEPHTYKAGDRVKLFYNRSSRPLMHNTEIWMHGGYNNWS 536


>tr|B8AUJ2|B8AUJ2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17490 PE=4 SV=1
Length = 1145

Score = 198 bits (503), Expect(2) = 3e-50
Identities = 99/188 (52%), Positives = 124/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ KL + GD W DV +P+ A VLDWV ADGP YDNNG QDFHA+VP
Sbjct: 471 SIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVVPNN 530

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ DL W E E IF LQ+ER+ RE+A +K+E TA++KA++KEKT + S++HI Y
Sbjct: 531 ISEDLFWVEEEHMIFKRLQKERKEREDADRRKSEITAKMKAEMKEKTMRDFLLSQKHIVY 590

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGKPEVW SFNRWTH GPL P KM+ S +
Sbjct: 591 TEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHLR 650

Query: 53 CNVKVPLD 30
V+VPLD
Sbjct: 651 ATVRVPLD 658



Score = 23.9 bits (50), Expect(2) = 3e-50
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 657 LDAYMMDFVFS 667



Score = 48.9 bits (115), Expect = 2e-04
Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 6/87 (6%)
Frame = -1

Query: 359 QEERE*REEATLKKAERTAEIKAQL---KEKTKSILVKSR---EHIFYTDPVDVQAGKEV 198
+EER EE +A+R A+ KA++ K K +++L + ++++Y +P +AG V
Sbjct: 382 EEERRKEEERAAMEADR-AQAKAEVEMNKNKLQNLLNSASRYADNLWYIEPHTYKAGDRV 440

Query: 197 KVFYNPSKTVLNGKPEVWLVASFNRWT 117
K+FYN S L E+W+ +N W+
Sbjct: 441 KLFYNRSSRPLMHNTEIWMHGGYNNWS 467


>tr|A4F2M4|A4F2M4_PHAVU Starch synthase III OS=Phaseolus vulgaris
GN=PvSSIII PE=2 SV=1
Length = 1165

Score = 199 bits (506), Expect(2) = 4e-50
Identities = 98/188 (52%), Positives = 123/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S++ +L +GGD W DV VP QA VLDWV ADG + +YDNN QDFHA+VP
Sbjct: 489 SIIERLVKSVLKGGDWWYADVIVPDQALVLDWVFADGAPQKAGIYDNNRKQDFHAIVPMV 548

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
P++ +W E E ++ QEER R+EA KAE+ A++KA+ KEKT + S++HI +
Sbjct: 549 TPDEQYWVEEEQLLYRKFQEERRLRDEAMRHKAEKIAQMKAETKEKTLKRFLLSQKHIVF 608

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
TDP+DVQAG V VFYNPS T LNGKPEVW SFN WTH G L P +MLP + K
Sbjct: 609 TDPLDVQAGSTVTVFYNPSNTNLNGKPEVWFRCSFNHWTHSNGSLPPQRMLPAENGTHVK 668

Query: 53 CNVKVPLD 30
+VKVPLD
Sbjct: 669 ASVKVPLD 676



Score = 22.3 bits (46), Expect(2) = 4e-50
Identities = 11/17 (64%), Positives = 11/17 (64%)
Frame = -2

Query: 52 AMSKSHLTAYMMDFVFS 2
A K L AY MDFVFS
Sbjct: 669 ASVKVPLDAYKMDFVFS 685



Score = 61.2 bits (147), Expect = 4e-08
Identities = 39/166 (23%), Positives = 80/166 (48%), Gaps = 19/166 (11%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPN--------DL 399
GD W+ + VP++A+ +D+V +G +YDNN +DF + G+ D
Sbjct: 325 GDWWSCQLYVPREAYQVDFVFFNGQ----NVYDNNDQKDFRIAIEGGMDASAFENFLLDE 380

Query: 398 HWQEVEDCIFNMLQEERE*REEATLK-----KAERTAEIKAQLKEKTKSI------LVKS 252
+E+E+ + ER+ E+ ++ KAE + + +++ +++ VKS
Sbjct: 381 KRKELEELARVQAERERQAEEQRRIEADRAAKAEDRSRARVEVQRMQETLPQLLKNAVKS 440

Query: 251 REHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTH 114
++++Y +P D + ++++YN S L E+W+ N W +
Sbjct: 441 IDNVWYIEPSDFKGKDLIRLYYNRSSGPLVHANEIWIHGGHNNWKY 486



Score = 37.4 bits (85), Expect = 0.65
Identities = 26/139 (18%), Positives = 63/139 (45%), Gaps = 5/139 (3%)
Frame = -1

Query: 404 DLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHI----- 240
D + +++ ++E R ++ ++A R +++ + ++ + I + E +
Sbjct: 210 DTNTDTLDEITEEAVEESRTANDDRIKEEASRLLKLELEENQRQQEIERIAEEKLSQGTK 269

Query: 239 FYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSL 60
+ P V+ ++++VF N S + L+ +P++ ++ +FN W K + K L
Sbjct: 270 LFVYPPVVKPDQDIEVFLNKSLSALSDEPQILIMGAFNDWKWKSFSVKLNKTR--LKGDW 327

Query: 59 FKCNVKVPLDCLYDGFCIF 3
+ C + VP + F F
Sbjct: 328 WSCQLYVPREAYQVDFVFF 346


>tr|Q01KB6|Q01KB6_ORYSA H0215F08.14 protein OS=Oryza sativa
GN=H0215F08.14 PE=4 SV=1
Length = 1214

Score = 196 bits (499), Expect(2) = 8e-50
Identities = 99/188 (52%), Positives = 123/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ KL + GD W DV +P+ A VLDWV ADGP YDNNG QDFHA+VP
Sbjct: 540 SIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVVPNN 599

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ DL W E E IF LQ+ER+ RE+A +K+E TA++KA +KEKT + S++HI Y
Sbjct: 600 ISEDLFWVEEEHMIFKRLQKERKEREDADRRKSEITAKMKAGMKEKTMRDFLLSQKHIVY 659

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGKPEVW SFNRWTH GPL P KM+ S +
Sbjct: 660 TEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHLR 719

Query: 53 CNVKVPLD 30
V+VPLD
Sbjct: 720 ATVRVPLD 727



Score = 23.9 bits (50), Expect(2) = 8e-50
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 726 LDAYMMDFVFS 736



Score = 67.8 bits (164), Expect = 4e-10
Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 24/170 (14%)
Frame = -1

Query: 554 GD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPNDLHWQEVEDC 375
GD W + +PKQA+ LD+V +G T+Y+NN + DF + ++++ ED
Sbjct: 376 GDWWCCKLHIPKQAYRLDFVFFNGD----TIYENNNHNDFVLQIE----SEINEHSFEDF 427

Query: 374 IFNMLQ------------------EERE*REEATLKKAERTAEIKAQL---KEKTKSILV 258
+ Q EER EE +A+R A+ KA++ K K +++L
Sbjct: 428 LVEEKQRELERLAAEEAERKRQAEEERRKEEERAAMEADR-AQAKAEVEMNKNKWQNLLN 486

Query: 257 KSR---EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWT 117
+ ++++Y +P +AG VK+FYN S L E+W+ +N W+
Sbjct: 487 SASRYADNLWYIEPHTYKAGDRVKLFYNRSSRPLMHNTEIWMHGGYNNWS 536


>tr|A4ZVI0|A4ZVI0_MAIZE Starch synthase IIIb-1 OS=Zea mays PE=2 SV=1
Length = 1191

Score = 196 bits (497), Expect(2) = 1e-49
Identities = 96/188 (51%), Positives = 124/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ +L + GD W ++V +P++A VLDWV ADGP YDNNG QDFHA+VP
Sbjct: 517 SIAERLVKSHEKEGDWWYVEVTLPERALVLDWVFADGPPGNARNYDNNGRQDFHAIVPNN 576

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ +D+ W E E IF LQ+ER RE A KAER+A++KA++KEKT + S++HI Y
Sbjct: 577 ISDDIFWVEEEHRIFTRLQQERRERESAERIKAERSAKMKAEMKEKTMRAFLLSQKHIVY 636

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGK EVW SFNRWTH GPL P KM+ +S +
Sbjct: 637 TEPLEVRAGTTVDVLYNPSNTVLNGKSEVWFRGSFNRWTHPSGPLPPQKMVKAENSSHLR 696

Query: 53 CNVKVPLD 30
V VPLD
Sbjct: 697 TTVSVPLD 704



Score = 23.9 bits (50), Expect(2) = 1e-49
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 703 LDAYMMDFVFS 713



Score = 66.2 bits (160), Expect = 1e-09
Identities = 46/172 (26%), Positives = 78/172 (45%), Gaps = 20/172 (11%)
Frame = -1

Query: 575 TFHSAE-GGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPN-- 405
T H +E GD W + +PKQA+ LD+V +G T+Y+NN + DF + +
Sbjct: 345 TMHRSELRGDWWCCKLYIPKQAYRLDFVFFNGD----TVYENNNHNDFFLEIESDIDEHS 400

Query: 404 -----------DLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQL---KEKTKS 267
+L E+ EER REE A+ ++++ KEK +
Sbjct: 401 FEDFLVEEKRKELERLAAEEAERKRQAEERHRREEERAAMEADRAQARSEVEMKKEKLRQ 460

Query: 266 ILVKSR---EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRW 120
+L + E+++Y +P + G V+++YN S L E+W+ +N W
Sbjct: 461 MLSSASRYAENLWYIEPNTYRGGDRVRLYYNRSSRSLMHNTEIWMHGGYNNW 512


>tr|B2Z9Y2|B2Z9Y2_SORBI Starch synthase IIIb OS=Sorghum bicolor PE=2
SV=1
Length = 1191

Score = 192 bits (489), Expect(2) = 1e-48
Identities = 95/188 (50%), Positives = 124/188 (65%)
Frame = -1

Query: 593 SMVGKLTFHSAEGGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRG 414
S+ KL + GD W ++V +P++A VL+WV ADGP YDNNG QDFHA+VP
Sbjct: 517 SIAEKLVKSHEKEGDWWYVEVTLPERALVLNWVFADGPPGNARNYDNNGRQDFHAIVPNN 576

Query: 413 VPNDLHWQEVEDCIFNMLQEERE*REEATLKKAERTAEIKAQLKEKTKSILVKSREHIFY 234
+ +D+ W + E IF LQ+ER RE A KAE +A++KA++KEKT + S++HI Y
Sbjct: 577 ISDDIFWVDEEHRIFTRLQQERREREGAERIKAEISAKMKAEMKEKTMRAFLLSQKHIVY 636

Query: 233 TDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRWTHKGGPLSPVKMLPVLGTSLFK 54
T+P++V+AG V V YNPS TVLNGKPEVW SFNRWTH GPL P KM+ S +
Sbjct: 637 TEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRGSFNRWTHPSGPLPPQKMVKTENGSHLR 696

Query: 53 CNVKVPLD 30
V+VPLD
Sbjct: 697 TTVRVPLD 704



Score = 23.9 bits (50), Expect(2) = 1e-48
Identities = 10/11 (90%), Positives = 10/11 (90%)
Frame = -2

Query: 34 LTAYMMDFVFS 2
L AYMMDFVFS
Sbjct: 703 LDAYMMDFVFS 713



Score = 63.9 bits (154), Expect = 6e-09
Identities = 46/173 (26%), Positives = 83/173 (47%), Gaps = 21/173 (12%)
Frame = -1

Query: 575 TFHSAE-GGD*WTIDVEVPKQAFVLDWVLADGPMEAVTLYDNNGYQDFHALVPRGVPN-- 405
T H +E GD W + +PKQA+ LD+V +G ++Y+NN + DF + +
Sbjct: 345 TLHKSELRGDWWCCKLYIPKQAYRLDFVFFNGD----SVYENNNHNDFFLEIESDIDEHS 400

Query: 404 -----------DLHWQEVEDCIFN-MLQEERE*REEATLKKAERTAEIKAQL---KEKTK 270
+L + E+ +EER EE +A+R A+ K+++ KEK +
Sbjct: 401 FDDFLVEEKQKELERLDAEEAERKRQAEEERRRAEERAAMEADR-AQAKSEVEKKKEKLR 459

Query: 269 SILVKSR---EHIFYTDPVDVQAGKEVKVFYNPSKTVLNGKPEVWLVASFNRW 120
+L + ++++Y +P + G V+++YN S L E+W+ +N W
Sbjct: 460 QMLSSASRYADNLWYIEPNTYRGGDRVRLYYNRSSRPLMHNTEIWMHGGYNNW 512