BP913310
Clone id YMU001_000028_H02
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_H02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCAAAAGGGAAATATGCTCTTATTCATTCTCAAAAGAAGCACAAGCAAGTTGCAGTCAAG
AATCATTGTGCATCCAAGTTCAAGCTGGATGACTAGGTTCCACTCAAGTTTTCAGAGGCT
GAACAATCAACTTGACATTGACAGTTTCATAGGCATGATTGTAGTATTGGTGATAGTTCA
ATCTGACGCTGACGGACTCGGATTATTCACAAGGTGAACCCAATTCAACAACAGACCATG
TCGAGGTGCCATTTAAGAACCTGCCTGACTTTTGTCAAACACAAGACAACCCACCATATA
TGATACATGATCTCTGTCCCATTGCAGTAAAAACGCAATGACACATTCACAAAGTTTTGC
AAACAAACTGCTCTAGCACAACGCATAATAAACCTGAGATGGCCCAGCTTCCCCGAGGGA
CAAGACTCTGAAATGCACTTGAAGCCATTCTGGATGGATATAGGGGGTTGTTCACACCTC
CAATGATAAAATCTACTTACCCCGCATTCAATGTG
■■Homology search results ■■ -
sp_hit_id Q971D7
Definition sp|Q971D7|SYFA_SULTO Phenylalanyl-tRNA synthetase alpha chain OS=Sulfolobus tokodaii
Align length 44
Score (bit) 29.6
E-value 8.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913310|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_H02.
(515 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q971D7|SYFA_SULTO Phenylalanyl-tRNA synthetase alpha chain OS... 30 8.7
sp|Q8BGR5|FA53B_MOUSE Protein FAM53B OS=Mus musculus GN=Fam53b P... 30 8.7

>sp|Q971D7|SYFA_SULTO Phenylalanyl-tRNA synthetase alpha chain
OS=Sulfolobus tokodaii GN=pheS PE=3 SV=1
Length = 469

Score = 29.6 bits (65), Expect = 8.7
Identities = 16/44 (36%), Positives = 24/44 (54%)
Frame = +3

Query: 231 TDHVEVPFKNLPDFCQTQDNPPYMIHDLCPIAVKTQ*HIHKVLQ 362
+D+VE+ F N Q QD+P IHD I+ K + K++Q
Sbjct: 237 SDYVEIEFYNFDLLFQAQDHPAREIHDSFAISGKGKLTDEKLIQ 280


>sp|Q8BGR5|FA53B_MOUSE Protein FAM53B OS=Mus musculus GN=Fam53b PE=2
SV=1
Length = 422

Score = 29.6 bits (65), Expect = 8.7
Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 9/55 (16%)
Frame = -1

Query: 512 IECGVSRFYHWR---------CEQPPISIQNGFKCISESCPSGKLGHLRFIMRCA 375
+ CG+ WR +QP SI ++C+ E C G L H + CA
Sbjct: 38 LSCGIMENDRWRDLDRKCPLQIDQPSASI---WECLPEKCQDGSLWHQEAVTACA 89


tr_hit_id A1TUF0
Definition tr|A1TUF0|A1TUF0_ACIAC Putative uncharacterized protein OS=Acidovorax avenae subsp. citrulli (strain AAC00-1)
Align length 43
Score (bit) 33.5
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913310|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_H02.
(515 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A1TUF0|A1TUF0_ACIAC Putative uncharacterized protein OS=Acido... 33 6.4
tr|A7QK39|A7QK39_VITVI Chromosome chr16 scaffold_110, whole geno... 33 6.4

>tr|A1TUF0|A1TUF0_ACIAC Putative uncharacterized protein
OS=Acidovorax avenae subsp. citrulli (strain AAC00-1)
GN=Aave_4047 PE=4 SV=1
Length = 378

Score = 33.5 bits (75), Expect = 6.4
Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 3/43 (6%)
Frame = -3

Query: 456 HPEWLQVHFRVLSL--GEAGPSQVYYALC*SSLFAKLC-ECVI 337
HP WLQ H S GEAGP+ V L + L A+ C +CVI
Sbjct: 253 HPAWLQTHLETYSRAHGEAGPADVQATL--TELTARACADCVI 293


>tr|A7QK39|A7QK39_VITVI Chromosome chr16 scaffold_110, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000940001
PE=4 SV=1
Length = 184

Score = 33.5 bits (75), Expect = 6.4
Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
Frame = -3

Query: 471 TTPYIHPEW--LQVHFRVLSLGEAGPSQVYYALC*SSLFAKLCECVIAFLLQWDRDHVS 301
T P+I PEW L +H + S+ + Q YA C +F K+C CV+ Q+ +++ S
Sbjct: 119 TPPHIMPEWYFLPIHAILPSILDNREHQFLYA-CWLYIFLKVCMCVVQVFDQFIKEYFS 176