BP913313
Clone id YMU001_000028_H05
Library
Length 494
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000028_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAAAGGCATCACCAAAAACTCAAATAACCCAAAAGTCGTCTGAAAGGCCGTCTTGTAGA
CGTCTCCCAGCGCGATTCGGATATAATGATATCCACTCTGGATATAATGATATCCACTCT
TCAAATCAATCCTGCTAAAGCAAGAGGATCCCTGTAATCTGTCGAGTATATCATTGATCC
TAGGAATCGGAAATTTGTGCTTGATGGTGATTTGGTTGAGAGCTCTATAATCGATGCACA
TTCTCCAAGATCCGTCTTTCTTCAAAACCAACAACTTGGGGGAGCAATACGGTGAAGTAC
TAGGTTGGACAAGACCCTTTTTCAAGAGGTCTTTCACTTGGTTCATAATCTCTCATTCTG
TGCTCGGCTCACACGGTAAGGTGGCTGGTTCGGTGGTGTACTTCCAGGAATCAAATCAAT
GGTATGATCTTCTGGACGAGCACGTGGTAACTCGCCTGGCAGGCCCTCTGAGAAGCAATC
GGCATGAGAGAGGA
■■Homology search results ■■ -
sp_hit_id Q99315
Definition sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae
Align length 119
Score (bit) 103.0
E-value 2.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913313|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_H05.
(494 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 103 2e-23
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 103 2e-23
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 93 8e-19
sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa prot... 91 4e-18
sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa prot... 91 4e-18
sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa prot... 91 4e-18
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 89 8e-18
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oeno... 89 1e-17
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 88 2e-17
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 87 3e-17
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from tra... 85 2e-16
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic m... 69 1e-11
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus... 67 4e-11
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf... 66 1e-10
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic ... 63 6e-10
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic ... 63 6e-10
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic ... 63 8e-10
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic ... 61 3e-09
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic ... 61 3e-09
sp|P19199|POL_COYMV Putative polyprotein OS=Commelina yellow mot... 57 5e-08
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched rin... 54 3e-07
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing... 50 6e-06
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing... 50 7e-06
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus... 47 6e-05
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform vi... 46 8e-05
sp|P63134|POK9_HUMAN HERV-K_5q13.3 provirus ancestral Pol protei... 46 1e-04
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=p... 45 1e-04
sp|P63133|POK6_HUMAN HERV-K_8p23.1 provirus ancestral Pol protei... 45 1e-04
sp|P63132|POK5_HUMAN HERV-K_19p13.11 provirus ancestral Pol prot... 45 1e-04
sp|P63128|POK4_HUMAN HERV-K_6q14.1 provirus ancestral Gag-Pol po... 45 1e-04

>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 103 bits (257), Expect(2) = 2e-23
Identities = 55/119 (46%), Positives = 74/119 (62%)
Frame = -2

Query: 358 E*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFPIPR 179
E EI V+ LL + PS SP SP +LV KKDG++R+C+DYR LN+ TI FP+PR
Sbjct: 609 EQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPR 668

Query: 178 INDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVMPF 2
I+++L R+ + F+ +DL SGYH I + D YKTAF T G +E+ VMPF
Sbjct: 669 IDNLLSRIGNAQIFTTLDL-------HSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPF 720



Score = 24.6 bits (52), Expect(2) = 2e-23
Identities = 9/30 (30%), Positives = 15/30 (50%)
Frame = -3

Query: 435 PEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
P H I++ PG+ P PY V+ + +
Sbjct: 583 PVKHDIEIKPGARLPRLQPYHVTEKNEQEI 612


>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 103 bits (257), Expect(2) = 2e-23
Identities = 55/119 (46%), Positives = 74/119 (62%)
Frame = -2

Query: 358 E*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFPIPR 179
E EI V+ LL + PS SP SP +LV KKDG++R+C+DYR LN+ TI FP+PR
Sbjct: 635 EQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPR 694

Query: 178 INDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVMPF 2
I+++L R+ + F+ +DL SGYH I + D YKTAF T G +E+ VMPF
Sbjct: 695 IDNLLSRIGNAQIFTTLDL-------HSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPF 746



Score = 24.6 bits (52), Expect(2) = 2e-23
Identities = 9/30 (30%), Positives = 15/30 (50%)
Frame = -3

Query: 435 PEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
P H I++ PG+ P PY V+ + +
Sbjct: 609 PVKHDIEIKPGARLPRLQPYHVTEKNEQEI 638


>sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from
transposon 297 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1059

Score = 92.8 bits (229), Expect = 8e-19
Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 5/130 (3%)
Frame = -2

Query: 376 PCEPSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGS-----WRMCIDYRALNQ 212
P + E E+ NQV+++L +GL++ S SPY SP +V KK + +R+ IDYR LN+
Sbjct: 213 PLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNE 272

Query: 211 ITIKHKFPIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTF 32
ITI ++PIP +++IL +L F+ IDL G+H I+ + KTAF T
Sbjct: 273 ITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEE-------SISKTAFSTKS 325

Query: 31 GLFEFLVMPF 2
G +E+L MPF
Sbjct: 326 GHYEYLRMPF 335


>sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa protein
type 3 OS=Schizosaccharomyces pombe GN=Tf2-11 PE=4 SV=1
Length = 1333

Score = 90.5 bits (223), Expect = 4e-18
Identities = 45/125 (36%), Positives = 75/125 (60%)
Frame = -2

Query: 376 PCEPSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKH 197
P P + +++ LK G+++ S + P + V KK+G+ RM +DY+ LN+ +
Sbjct: 419 PLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPN 478

Query: 196 KFPIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEF 17
+P+P I +L ++QGS+ F+++DLK S YH IR+ GD +K AF+ G+FE+
Sbjct: 479 IYPLPLIEQLLAKIQGSTIFTKLDLK-------SAYHLIRVRKGDEHKLAFRCPRGVFEY 531

Query: 16 LVMPF 2
LVMP+
Sbjct: 532 LVMPY 536


>sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa protein
type 2 OS=Schizosaccharomyces pombe GN=Tf2-7 PE=2 SV=1
Length = 1333

Score = 90.5 bits (223), Expect = 4e-18
Identities = 45/125 (36%), Positives = 75/125 (60%)
Frame = -2

Query: 376 PCEPSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKH 197
P P + +++ LK G+++ S + P + V KK+G+ RM +DY+ LN+ +
Sbjct: 419 PLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPN 478

Query: 196 KFPIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEF 17
+P+P I +L ++QGS+ F+++DLK S YH IR+ GD +K AF+ G+FE+
Sbjct: 479 IYPLPLIEQLLAKIQGSTIFTKLDLK-------SAYHLIRVRKGDEHKLAFRCPRGVFEY 531

Query: 16 LVMPF 2
LVMP+
Sbjct: 532 LVMPY 536


>sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa protein
type 1 OS=Schizosaccharomyces pombe GN=Tf2-1 PE=2 SV=1
Length = 1333

Score = 90.5 bits (223), Expect = 4e-18
Identities = 45/125 (36%), Positives = 75/125 (60%)
Frame = -2

Query: 376 PCEPSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKH 197
P P + +++ LK G+++ S + P + V KK+G+ RM +DY+ LN+ +
Sbjct: 419 PLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPN 478

Query: 196 KFPIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEF 17
+P+P I +L ++QGS+ F+++DLK S YH IR+ GD +K AF+ G+FE+
Sbjct: 479 IYPLPLIEQLLAKIQGSTIFTKLDLK-------SAYHLIRVRKGDEHKLAFRCPRGVFEY 531

Query: 16 LVMPF 2
LVMP+
Sbjct: 532 LVMPY 536


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 89.4 bits (220), Expect = 8e-18
Identities = 52/123 (42%), Positives = 72/123 (58%), Gaps = 6/123 (4%)
Frame = -2

Query: 352 EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDG------SWRMCIDYRALNQITIKHKF 191
EI QV+ L+K +V+PS S Y SP LLV KK WR+ IDYR +N+ + KF
Sbjct: 329 EIQAQVQKLIKDKIVEPSVSQYNSPLLLVPKKSSPNSDKKKWRLVIDYRQINKKLLADKF 388

Query: 190 PIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLV 11
P+PRI+DILD+L + FS +DL SG+H I+ + G T+F T+ G + F
Sbjct: 389 PLPRIDDILDQLGRAKYFSCLDLMSGFHQIE-------LDEGSRDITSFSTSNGSYRFTR 441

Query: 10 MPF 2
+PF
Sbjct: 442 LPF 444


>sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog
OS=Oenothera bertiana PE=4 SV=1
Length = 142

Score = 89.0 bits (219), Expect = 1e-17
Identities = 44/83 (53%), Positives = 59/83 (71%)
Frame = -2

Query: 250 SWRMCIDYRALNQITIKHKFPIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIA 71
S RMCIDYRAL ++TIK+K+PIPR++D+ DRL ++ F+++DL+ SGY +RIA
Sbjct: 5 SLRMCIDYRALTKVTIKNKYPIPRVDDLFDRLAQATWFTKLDLR-------SGYWQVRIA 57

Query: 70 LGDVYKTAFQTTFGLFEFLVMPF 2
GD KT T +G FEF VMPF
Sbjct: 58 KGDEPKTTCVTRYGSFEFRVMPF 80


>sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from
transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1058

Score = 87.8 bits (216), Expect = 2e-17
Identities = 49/124 (39%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
Frame = -2

Query: 358 E*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGS-----WRMCIDYRALNQITIKHK 194
E E+ +Q++D+L +G+++ S SPY SP +V KK + +R+ IDYR LN+IT+ +
Sbjct: 220 EQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDR 279

Query: 193 FPIPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFL 14
PIP +++IL +L + F+ IDL G+H I+ V KTAF T G +E+L
Sbjct: 280 HPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPE-------SVSKTAFSTKHGHYEYL 332

Query: 13 VMPF 2
MPF
Sbjct: 333 RMPF 336


>sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from
transposon opus OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1003

Score = 87.4 bits (215), Expect = 3e-17
Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
Frame = -2

Query: 352 EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKK-----DGSWRMCIDYRALNQITIKHKFP 188
E+ Q+ +LL+ G+++PS SPY SP +V KK + +RM +D++ LN +TI +P
Sbjct: 138 EVERQIDELLQDGIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNTVTIPDTYP 197

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IP IN L L + F+ +DL SG+H I + D+ KTAF T G +EFL +
Sbjct: 198 IPDINATLASLGNAKYFTTLDL-------TSGFHQIHMKESDIPKTAFSTLNGKYEFLRL 250

Query: 7 PF 2
PF
Sbjct: 251 PF 252


tr_hit_id Q9AXI7
Definition tr|Q9AXI7|Q9AXI7_PHACN Putative POL3-like reverse transcriptase OS=Phaseolus coccineus
Align length 122
Score (bit) 142.0
E-value 3.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913313|Adiantum capillus-veneris mRNA, clone:
YMU001_000028_H05.
(494 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9AXI7|Q9AXI7_PHACN Putative POL3-like reverse transcriptase ... 142 3e-39
tr|Q93WG4|Q93WG4_ORYSA Putative retroelement OS=Oryza sativa GN=... 140 7e-39
tr|Q7XFI5|Q7XFI5_ORYSJ Retrotransposon protein, putative, Ty3-gy... 140 7e-39
tr|Q6UUJ1|Q6UUJ1_ORYSJ Putative gag-pol polyprotein (Putative po... 140 7e-39
tr|Q9SLQ0|Q9SLQ0_ORYSI Gag-pol polyprotein (Fragment) OS=Oryza s... 140 7e-39
tr|Q7XWZ0|Q7XWZ0_ORYSJ OSJNBb0072N21.12 protein OS=Oryza sativa ... 138 7e-39
tr|Q7XSL7|Q7XSL7_ORYSJ OSJNBa0035O13.13 protein OS=Oryza sativa ... 139 7e-39
tr|Q6UUF6|Q6UUF6_ORYSJ Putative gag-pol polyprotein OS=Oryza sat... 138 3e-38
tr|Q94I07|Q94I07_ORYSA Putative retroelement OS=Oryza sativa GN=... 139 3e-38
tr|Q7XG23|Q7XG23_ORYSJ Retrotransposon protein, putative, Ty3-gy... 139 3e-38
tr|Q53J66|Q53J66_ORYSJ Retrotransposon protein, putative, Ty3-gy... 137 3e-38
tr|Q53JB7|Q53JB7_ORYSJ Retrotransposon gag protein, putative OS=... 137 3e-38
tr|Q65XD2|Q65XD2_ORYSJ Putative polyprotein OS=Oryza sativa subs... 137 7e-38
tr|Q7XWN9|Q7XWN9_ORYSJ OSJNBa0032B23.3 protein OS=Oryza sativa s... 137 7e-38
tr|Q8L7J3|Q8L7J3_MAIZE Gag-pol polyprotein OS=Zea mays PE=4 SV=1 137 1e-37
tr|Q7XQZ3|Q7XQZ3_ORYSJ OSJNBb0045P24.9 protein OS=Oryza sativa s... 141 2e-37
tr|Q7XRN3|Q7XRN3_ORYSJ OSJNBa0024J22.19 protein OS=Oryza sativa ... 134 2e-37
tr|Q01KW5|Q01KW5_ORYSA H0211A12.9 protein OS=Oryza sativa GN=H02... 134 2e-37
tr|Q6UUM9|Q6UUM9_ORYSJ Putative gag-pol polyprotein OS=Oryza sat... 135 4e-37
tr|Q5MG92|Q5MG92_IPOBA Putative retrotransposon polyprotein OS=I... 133 5e-37
tr|Q7XRJ2|Q7XRJ2_ORYSJ OSJNBa0042D13.18 protein OS=Oryza sativa ... 134 6e-37
tr|Q8LM42|Q8LM42_ORYSJ Putative retroelement OS=Oryza sativa sub... 134 6e-37
tr|Q339J2|Q339J2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 134 6e-37
tr|Q8S6I8|Q8S6I8_ORYSA Putative retroelement OS=Oryza sativa GN=... 134 6e-37
tr|Q5NRP7|Q5NRP7_SOLDE Putative gag-pol polyprotein, identical O... 137 1e-36
tr|Q5NRP4|Q5NRP4_SOLDE Putative gag-pol polyprotein, identical O... 137 1e-36
tr|A5BU14|A5BU14_VITVI Putative uncharacterized protein OS=Vitis... 133 1e-36
tr|Q94BM1|Q94BM1_HORVU Gag-pol polyprotein OS=Hordeum vulgare PE... 132 1e-36
tr|A5ACJ6|A5ACJ6_VITVI Putative uncharacterized protein OS=Vitis... 133 2e-36
tr|Q94BM2|Q94BM2_HORVU Gag-pol polyprotein OS=Hordeum vulgare PE... 131 3e-36

>tr|Q9AXI7|Q9AXI7_PHACN Putative POL3-like reverse transcriptase
OS=Phaseolus coccineus GN=POL3-like PE=4 SV=1
Length = 343

Score = 142 bits (359), Expect(2) = 3e-39
Identities = 74/122 (60%), Positives = 89/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI +QV+DLL+KG VQ S SP P LLV KKDG WRMC D RA+N ITIK++ P
Sbjct: 54 PEETKEIESQVQDLLEKGWVQKSLSPCAVPVLLVPKKDGKWRMCCDCRAINNITIKYRHP 113

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS+ FS+IDLK SGYH IRI GD +KTAF+T FGL+E+LVM
Sbjct: 114 IPRLDDMLDELHGSTLFSKIDLK-------SGYHQIRIKEGDEWKTAFKTKFGLYEWLVM 166

Query: 7 PF 2
PF
Sbjct: 167 PF 168



Score = 42.4 bits (98), Expect(2) = 3e-39
Identities = 19/45 (42%), Positives = 28/45 (62%)
Frame = -3

Query: 480 DCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
D FS+ P LP R +H ID IPG++ PN+PPYR + + + +
Sbjct: 16 DLFSQEGPIGLPPLRGIEHQIDFIPGASLPNRPPYRTNPEETKEI 60


>tr|Q93WG4|Q93WG4_ORYSA Putative retroelement OS=Oryza sativa
GN=OSJNBa0045C13.1 PE=4 SV=1
Length = 1708

Score = 140 bits (353), Expect(2) = 7e-39
Identities = 71/122 (58%), Positives = 89/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 756 PEETKEIQRQVQELLDKGYVRESLSPCSIPVLLVPKKDGSWRMCVDCRAINNITIRYRHP 815

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS+IDL+ SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 816 IPRLDDMLDELSGSLVFSKIDLR-------SGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 868

Query: 7 PF 2
PF
Sbjct: 869 PF 870



Score = 43.5 bits (101), Expect(2) = 7e-39
Identities = 19/47 (40%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+AD F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 716 YADIFPKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 762


>tr|Q7XFI5|Q7XFI5_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass (Putative gag-pol polyprotein) OS=Oryza sativa
subsp. japonica GN=OSJNBb0052C09.15 PE=4 SV=1
Length = 1708

Score = 140 bits (353), Expect(2) = 7e-39
Identities = 71/122 (58%), Positives = 89/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 756 PEETKEIQRQVQELLDKGYVRESLSPCSIPVLLVPKKDGSWRMCVDCRAINNITIRYRHP 815

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS+IDL+ SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 816 IPRLDDMLDELSGSLVFSKIDLR-------SGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 868

Query: 7 PF 2
PF
Sbjct: 869 PF 870



Score = 43.5 bits (101), Expect(2) = 7e-39
Identities = 19/47 (40%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+AD F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 716 YADIFPKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 762


>tr|Q6UUJ1|Q6UUJ1_ORYSJ Putative gag-pol polyprotein (Putative
polyprotein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0003M24.1 PE=4 SV=1
Length = 1616

Score = 140 bits (353), Expect(2) = 7e-39
Identities = 71/122 (58%), Positives = 89/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 756 PEETKEIQRQVQELLDKGYVRESLSPCSVPVLLVPKKDGSWRMCVDCRAINNITIRYRHP 815

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS+IDL+ SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 816 IPRLDDMLDELSGSLVFSKIDLR-------SGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 868

Query: 7 PF 2
PF
Sbjct: 869 PF 870



Score = 43.5 bits (101), Expect(2) = 7e-39
Identities = 19/47 (40%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+AD F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 716 YADIFPKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 762


>tr|Q9SLQ0|Q9SLQ0_ORYSI Gag-pol polyprotein (Fragment) OS=Oryza sativa
subsp. indica GN=gag-pol PE=4 SV=1
Length = 1587

Score = 140 bits (353), Expect(2) = 7e-39
Identities = 71/122 (58%), Positives = 89/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 756 PEETKEIQRQVQELLDKGYVRESLSPCSVPVLLVPKKDGSWRMCVDCRAINNITIRYRHP 815

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS+IDL+ SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 816 IPRLDDMLDELSGSLVFSKIDLR-------SGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 868

Query: 7 PF 2
PF
Sbjct: 869 PF 870



Score = 43.5 bits (101), Expect(2) = 7e-39
Identities = 19/47 (40%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+AD F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 716 YADIFPKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 762


>tr|Q7XWZ0|Q7XWZ0_ORYSJ OSJNBb0072N21.12 protein OS=Oryza sativa
subsp. japonica GN=OSJNBb0072N21.12 PE=4 SV=2
Length = 1239

Score = 138 bits (348), Expect(2) = 7e-39
Identities = 70/122 (57%), Positives = 88/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 534 PEETKEIQRQVQELLDKGYVRESLSPCAVPVLLVPKKDGSWRMCVDCRAINNITIRYRHP 593

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS+IDL+ SGYH IR+ LGD +KTAF+T F L+E+LVM
Sbjct: 594 IPRLDDMLDELSGSLVFSKIDLR-------SGYHQIRMKLGDEWKTAFKTKFSLYEWLVM 646

Query: 7 PF 2
PF
Sbjct: 647 PF 648



Score = 45.4 bits (106), Expect(2) = 7e-39
Identities = 20/47 (42%), Positives = 31/47 (65%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+AD FS+ +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 494 YADIFSKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 540


>tr|Q7XSL7|Q7XSL7_ORYSJ OSJNBa0035O13.13 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0035O13.13 PE=4 SV=2
Length = 1021

Score = 139 bits (349), Expect(2) = 7e-39
Identities = 69/117 (58%), Positives = 87/117 (74%)
Frame = -2

Query: 352 EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFPIPRIN 173
EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ PIPR++
Sbjct: 539 EIQRQVQELLDKGYVRESLSPCAVPVLLVPKKDGSWRMCVDCRAINNITIRYRHPIPRLD 598

Query: 172 DILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVMPF 2
D+LD L GS FS+IDL+ SGYH IR+ LGD +KT F+T FGL+E+LVMPF
Sbjct: 599 DMLDELSGSLVFSKIDLR-------SGYHQIRMKLGDEWKTTFKTKFGLYEWLVMPF 648



Score = 45.1 bits (105), Expect(2) = 7e-39
Identities = 19/49 (38%), Positives = 31/49 (63%)
Frame = -3

Query: 492 LSHADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+ +AD F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 492 MEYADIFPKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNSGETKEI 540


>tr|Q6UUF6|Q6UUF6_ORYSJ Putative gag-pol polyprotein OS=Oryza sativa
subsp. japonica GN=OSJNBa0038J12.13 PE=4 SV=1
Length = 1619

Score = 138 bits (348), Expect(2) = 3e-38
Identities = 71/122 (58%), Positives = 88/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV++LL KG V+ S SP P LLV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 652 PEETKEIQRQVQELLDKGYVRESLSPCSVPVLLVPKKDGSWRMCVDCRAINNITIRYRHP 711

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS+IDL SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 712 IPRLDDMLDELSGSLVFSKIDL-------CSGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 764

Query: 7 PF 2
PF
Sbjct: 765 PF 766



Score = 43.5 bits (101), Expect(2) = 3e-38
Identities = 19/47 (40%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
+AD F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 612 YADIFPKEVPPGLPPIRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 658


>tr|Q94I07|Q94I07_ORYSA Putative retroelement OS=Oryza sativa
GN=OSJNBa0034E23.18 PE=4 SV=1
Length = 2447

Score = 139 bits (349), Expect(2) = 3e-38
Identities = 69/122 (56%), Positives = 88/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV +LL KG V+ S SP P +LV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 728 PEETKEIQRQVHELLDKGYVRESLSPCAVPVILVPKKDGSWRMCVDCRAINNITIRYRHP 787

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS++DL+ SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 788 IPRLDDMLDELSGSIVFSKVDLR-------SGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 840

Query: 7 PF 2
PF
Sbjct: 841 PF 842



Score = 42.7 bits (99), Expect(2) = 3e-38
Identities = 18/47 (38%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
++D F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 688 YSDVFPKEVPPGLPPVRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 734


>tr|Q7XG23|Q7XG23_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os10g16560 PE=4 SV=1
Length = 2447

Score = 139 bits (349), Expect(2) = 3e-38
Identities = 69/122 (56%), Positives = 88/122 (72%)
Frame = -2

Query: 367 PSTE*EIMNQVKDLLKKGLVQPSTSPYCSPKLLVLKKDGSWRMCIDYRALNQITIKHKFP 188
P EI QV +LL KG V+ S SP P +LV KKDGSWRMC+D RA+N ITI+++ P
Sbjct: 728 PEETKEIQRQVHELLDKGYVRESLSPCAVPVILVPKKDGSWRMCVDCRAINNITIRYRHP 787

Query: 187 IPRINDILDRLQGSSCFSRIDLKSGYHYIQSGYHYIRIALGDVYKTAFQTTFGLFEFLVM 8
IPR++D+LD L GS FS++DL+ SGYH IR+ LGD +KTAF+T FGL+E+LVM
Sbjct: 788 IPRLDDMLDELSGSIVFSKVDLR-------SGYHQIRMKLGDEWKTAFKTKFGLYEWLVM 840

Query: 7 PF 2
PF
Sbjct: 841 PF 842



Score = 42.7 bits (99), Expect(2) = 3e-38
Identities = 18/47 (38%), Positives = 30/47 (63%)
Frame = -3

Query: 486 HADCFSEGLPGELPRARPEDHTIDLIPGSTPPNQPPYRVSRAQNERL 346
++D F + +P LP R +H IDLIPG++ PN+ PYR + + + +
Sbjct: 688 YSDVFPKEVPPGLPPVRGIEHQIDLIPGASLPNRAPYRTNPEETKEI 734