BP913346
Clone id YMU001_000029_C03
Library
Length 449
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000029_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGCTACCTCTTTCGCTACTCAGGCCAACGCCCTTCTCCGCAAGAATCTCAATTTCCAGG
TTATAGACGAAAAATGGCTACAAACTGTTGCCTGGTTGGTTTTCCAATAGTACTGTGCAC
ACTTCTTGTTCTTTTCCAAGTCATCATAAACAAAGTTTTGAGTGGTCCAAGCCATTCATG
TGGGTGTACTTGTTTACCAACAAATGCCAGTGGGATCTGCAAGAAGGAATGTGGTTTAGA
GTACTCAACTCCAGCACAAGCGGTATTTTGTGCAATTCCAAAGCCACCACAGTGGCCAGC
AGTTTTGCAAGTTCCTTCTTCTCAACATAGAGCAATAGATGAGCATAACAACGAGTTTCC
AGGCTTGCCGGATGTTTCATGCCGGTGGTGGGGCACATGTCCCATAAGCTTTCTGTATAC
TGGCAAGAGTCAGCTTGTTGCAAATAACA
■■Homology search results ■■ -
sp_hit_id Q9STT5
Definition sp|Q9STT5|ATH6_ARATH Probable ABC2 homolog 6 OS=Arabidopsis thaliana
Align length 125
Score (bit) 107.0
E-value 4.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913346|Adiantum capillus-veneris mRNA, clone:
YMU001_000029_C03.
(449 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9STT5|ATH6_ARATH Probable ABC2 homolog 6 OS=Arabidopsis thal... 107 4e-26
sp|Q8LPK0|ATH7_ARATH ABC2 homolog 7 OS=Arabidopsis thaliana GN=A... 82 4e-18
sp|Q9STT8|ATH3_ARATH Putative ABC2 homolog 3 OS=Arabidopsis thal... 82 8e-18
sp|Q9FLT8|ATH16_ARATH Putative ABC2 homolog 16 OS=Arabidopsis th... 66 8e-14
sp|Q9FLT4|ATH14_ARATH ABC2 homolog 14 OS=Arabidopsis thaliana GN... 63 3e-12
sp|P04764|ENOA_RAT Alpha-enolase OS=Rattus norvegicus GN=Eno1 PE... 32 1.6
sp|Q5NGY1|MRAW_FRATT S-adenosyl-L-methionine-dependent methyltra... 31 2.1
sp|P07322|ENOB_CHICK Beta-enolase OS=Gallus gallus GN=ENO3 PE=1 ... 31 2.1
sp|O05519|YDIF_BACSU Uncharacterized ABC transporter ATP-binding... 30 3.6
sp|P69499|CXI_CONST I-superfamily conotoxin OS=Conus striatus PE... 30 3.6
sp|Q5K027|SIAT2_ORYLA Beta-galactoside alpha-2,6-sialyltransfera... 30 4.7
sp|Q4R5L2|ENOA_MACFA Alpha-enolase OS=Macaca fascicularis GN=ENO... 30 4.7
sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens GN=ENO1 PE=1 ... 30 4.7
sp|P35352|CAR3_DICDI Cyclic AMP receptor 3 OS=Dictyostelium disc... 30 4.7
sp|Q61329|ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musc... 30 6.1
sp|P20428|MYOG_RAT Myogenin OS=Rattus norvegicus GN=Myog PE=2 SV=1 30 6.1
sp|Q60553|ERBB2_MESAU Receptor tyrosine-protein kinase erbB-2 OS... 29 8.0
sp|P04626|ERBB2_HUMAN Receptor tyrosine-protein kinase erbB-2 OS... 29 8.0
sp|O18735|ERBB2_CANFA Receptor tyrosine-protein kinase erbB-2 OS... 29 8.0
sp|P17182|ENOA_MOUSE Alpha-enolase OS=Mus musculus GN=Eno1 PE=1 ... 29 8.0

>sp|Q9STT5|ATH6_ARATH Probable ABC2 homolog 6 OS=Arabidopsis
thaliana GN=ATH6 PE=1 SV=2
Length = 935

Score = 107 bits (268), Expect(2) = 4e-26
Identities = 51/125 (40%), Positives = 79/125 (63%), Gaps = 2/125 (1%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIIN-KVLSGPSHSCGCTCLPTNASGICKKE-CGL 238
+R + +N L+ P LC LLV+ Q++ + +V + + CGC C+ N +G C++E CGL
Sbjct: 25 KRNLWSNIRLIMIPFYLCILLVIIQILFDTQVNNSADNRCGCECIERNRAGKCQRELCGL 84

Query: 239 EYSTPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLY 418
E+S P QA FC+IP+PP WP +LQ+P + R + GL D SCR G+CP++ L+
Sbjct: 85 EHSKPDQAFFCSIPRPPLWPPLLQIPRPESR-------DVRGLRDDSCRRTGSCPVTILF 137

Query: 419 TGKSQ 433
TG ++
Sbjct: 138 TGNNR 142



Score = 30.4 bits (67), Expect(2) = 4e-26
Identities = 13/17 (76%), Positives = 16/17 (94%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQ 59
SF+T+ANALLRKNL +Q
Sbjct: 8 SFSTRANALLRKNLTYQ 24


>sp|Q8LPK0|ATH7_ARATH ABC2 homolog 7 OS=Arabidopsis thaliana GN=ATH7
PE=2 SV=2
Length = 901

Score = 82.0 bits (201), Expect(2) = 4e-18
Identities = 43/127 (33%), Positives = 65/127 (51%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEY 244
+R + +N L+ P LC LL++ Q++ + + CGC +K CGL Y
Sbjct: 25 KRNIWSNIRLITIPFFLCLLLLVIQMLFDTQFNDVHGQCGCN----------EKTCGLRY 74

Query: 245 STPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTG 424
ST QA FCAIP PPQW +LQ+P+ ++RA + + T P +FL+TG
Sbjct: 75 STSEQAAFCAIPNPPQWTPLLQIPAPEYRAAIPYPSH-------------TSPATFLFTG 121

Query: 425 KSQLVAN 445
+Q + N
Sbjct: 122 NNQSLGN 128



Score = 29.3 bits (64), Expect(2) = 4e-18
Identities = 14/17 (82%), Positives = 15/17 (88%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQ 59
SF TQA+ALLRKNL FQ
Sbjct: 8 SFLTQADALLRKNLVFQ 24


>sp|Q9STT8|ATH3_ARATH Putative ABC2 homolog 3 OS=Arabidopsis
thaliana GN=ATH3 PE=3 SV=1
Length = 895

Score = 82.0 bits (201), Expect(2) = 8e-18
Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 2/115 (1%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIIN-KVLSGPSHSCGCTCLPTNASGIC-KKECGL 238
+R + +N L+ P LC LLV QV+ + +V + + CGC C+ N G C +K CGL
Sbjct: 25 KRNIWSNVRLIVIPFYLCVLLVGIQVLFDTQVNNSADNRCGCRCIHKNGDGKCERKSCGL 84

Query: 239 EYSTPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCP 403
+YS+ QA FCA P PP +LQ+P + R +D + SCR G+CP
Sbjct: 85 QYSSLTQASFCAFPNPPPLLPLLQIPRPETRLVDPARS--------SCRRTGSCP 131



Score = 28.1 bits (61), Expect(2) = 8e-18
Identities = 12/17 (70%), Positives = 14/17 (82%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQ 59
SF T+ANAL RKNL +Q
Sbjct: 8 SFLTRANALFRKNLTYQ 24


>sp|Q9FLT8|ATH16_ARATH Putative ABC2 homolog 16 OS=Arabidopsis
thaliana GN=ATH16 PE=3 SV=1
Length = 917

Score = 66.2 bits (160), Expect(2) = 8e-14
Identities = 36/120 (30%), Positives = 57/120 (47%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEY 244
R+ + TN L+ P+ LC +L+ Q +++ ++ G S C T GIC
Sbjct: 25 RKHIWTNVRLILVPLFLCLILLAIQQVLDALMKGVSDMSNCGGNVTLPGGICP------- 77

Query: 245 STPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTG 424
IP PP P +LQ+P + R++ + LPD CR G+CP++ L+TG
Sbjct: 78 ----------IPNPPSLPPMLQIPQHELRSVKTDFFSYKDLPDKLCRETGSCPVTILFTG 127



Score = 30.4 bits (67), Expect(2) = 8e-14
Identities = 14/17 (82%), Positives = 15/17 (88%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQ 59
SF TQANALLRKNL +Q
Sbjct: 8 SFWTQANALLRKNLTYQ 24


>sp|Q9FLT4|ATH14_ARATH ABC2 homolog 14 OS=Arabidopsis thaliana
GN=ATH14 PE=1 SV=1
Length = 907

Score = 62.8 bits (151), Expect(2) = 3e-12
Identities = 38/122 (31%), Positives = 58/122 (47%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEY 244
RR + TN LV P++LC L+ Q++++ V++ + C + G C
Sbjct: 25 RRHIWTNIRLVLVPLLLCLFLLGIQLLLDVVVNKAADLTKCGSQDDFSIGDCP------- 77

Query: 245 STPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTG 424
IP PP P +LQ+P + RA+ + LPD SCR GTCP++ L TG
Sbjct: 78 ----------IPNPPLLPPLLQIPEPESRAVSGGFFSYNDLPDKSCRKTGTCPVTILLTG 127

Query: 425 KS 430
+
Sbjct: 128 NN 129



Score = 28.5 bits (62), Expect(2) = 3e-12
Identities = 13/17 (76%), Positives = 14/17 (82%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQ 59
SF QANALLRKNL +Q
Sbjct: 8 SFWAQANALLRKNLTYQ 24


>sp|P04764|ENOA_RAT Alpha-enolase OS=Rattus norvegicus GN=Eno1 PE=1
SV=4
Length = 434

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/33 (39%), Positives = 21/33 (63%)
Frame = +3

Query: 291 SGQQFCKFLLLNIEQ*MSITTSFQACRMFHAGG 389
+G++ C LLL + Q S+T S QAC++ + G
Sbjct: 332 AGEKSCNCLLLKVNQIGSVTESLQACKLAQSNG 364


>sp|Q5NGY1|MRAW_FRATT S-adenosyl-L-methionine-dependent
methyltransferase mraW OS=Francisella tularensis subsp.
tularensis GN=mraW PE=3 SV=1
Length = 305

Score = 31.2 bits (69), Expect = 2.1
Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
Frame = -1

Query: 446 YLQQADSCQYTESLWDMC-PTTGMKHPASLETRCYAHLLLYV--EKKELAKLLATVVAL 279
Y+QQ S + T L ++ T G K + TRC+ L +YV E K+L LL ++A+
Sbjct: 166 YIQQNGSIRKTLELAELILATIGKKEKKNPATRCFQALRIYVNNELKDLEALLENILAV 224


>sp|P07322|ENOB_CHICK Beta-enolase OS=Gallus gallus GN=ENO3 PE=1
SV=3
Length = 434

Score = 31.2 bits (69), Expect = 2.1
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = +3

Query: 282 SHHSGQQFCKFLLLNIEQ*MSITTSFQACRMFHAGG 389
+H + Q C LLL + Q S+T S QAC++ + G
Sbjct: 329 AHGAEQHACNCLLLKVNQIGSVTESIQACKLAQSHG 364


>sp|O05519|YDIF_BACSU Uncharacterized ABC transporter ATP-binding
protein ydiF OS=Bacillus subtilis GN=ydiF PE=3 SV=1
Length = 642

Score = 30.4 bits (67), Expect = 3.6
Identities = 16/40 (40%), Positives = 24/40 (60%)
Frame = +2

Query: 317 SSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTGKSQL 436
+S R +DE +E+PGLP+ R TC +FL++G L
Sbjct: 403 TSSKRVLDELWDEYPGLPEKEIR---TCLGNFLFSGDDVL 439


>sp|P69499|CXI_CONST I-superfamily conotoxin OS=Conus striatus PE=2
SV=1
Length = 68

Score = 30.4 bits (67), Expect = 3.6
Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
Frame = +2

Query: 68 RKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGC---TCLPTNASGICKKECGL 238
R + +C L+ +++C L LFQV++ + PS C C T SG+C+ C L
Sbjct: 4 RLTSVSCFLL---VIVC--LNLFQVVLTRRCVPPSRYCTRHRPCCRGTCCSGLCRPMCNL 58

Query: 239 EYSTPA 256
Y A
Sbjct: 59 WYGKRA 64


tr_hit_id B8BAI4
Definition tr|B8BAI4|B8BAI4_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 129
Score (bit) 121.0
E-value 6.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913346|Adiantum capillus-veneris mRNA, clone:
YMU001_000029_C03.
(449 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8BAI4|B8BAI4_ORYSI Putative uncharacterized protein OS=Oryza... 121 6e-30
tr|Q0J5V8|Q0J5V8_ORYSJ Os08g0398300 protein OS=Oryza sativa subs... 120 1e-29
tr|Q6ZIV9|Q6ZIV9_ORYSJ Putative ABC transporter (Putative unchar... 120 1e-29
tr|A9S3Q7|A9S3Q7_PHYPA ATP-binding cassette transporter, subfami... 123 4e-29
tr|A7QI68|A7QI68_VITVI Chromosome chr17 scaffold_101, whole geno... 120 4e-29
tr|A9SZT0|A9SZT0_PHYPA ATP-binding cassette transporter, subfami... 116 5e-27
tr|Q69XA0|Q69XA0_ORYSJ Os06g0589300 protein OS=Oryza sativa subs... 115 8e-27
tr|A3BD56|A3BD56_ORYSJ Putative uncharacterized protein OS=Oryza... 115 8e-27
tr|B8B454|B8B454_ORYSI Putative uncharacterized protein OS=Oryza... 114 2e-26
tr|B8BES4|B8BES4_ORYSI Putative uncharacterized protein OS=Oryza... 120 4e-26
tr|A9THY7|A9THY7_PHYPA ATP-binding cassette transporter, subfami... 111 1e-25
tr|A9TMH9|A9TMH9_PHYPA ATP-binding cassette transporter, subfami... 105 9e-22
tr|B8BAI5|B8BAI5_ORYSI Putative uncharacterized protein OS=Oryza... 91 9e-18
tr|Q6ZIV8|Q6ZIV8_ORYSJ Putative ABC transporter OS=Oryza sativa ... 91 1e-17
tr|B8AE55|B8AE55_ORYSI Putative uncharacterized protein OS=Oryza... 69 9e-11
tr|A5CA49|A5CA49_VITVI Putative uncharacterized protein OS=Vitis... 64 2e-10
tr|A8J6E7|A8J6E7_CHLRE Predicted protein OS=Chlamydomonas reinha... 66 8e-10
tr|Q6H8C3|Q6H8C3_ORYSJ Putative ABC transporter OS=Oryza sativa ... 66 1e-09
tr|Q0E2V4|Q0E2V4_ORYSJ Os02g0211000 protein OS=Oryza sativa subs... 66 1e-09
tr|A3BY10|A3BY10_ORYSJ Putative uncharacterized protein OS=Oryza... 65 2e-09
tr|A8IAB7|A8IAB7_CHLRE Predicted protein OS=Chlamydomonas reinha... 52 1e-05
tr|Q4N5D7|Q4N5D7_THEPA Putative uncharacterized protein OS=Theil... 37 0.38
tr|B7G813|B7G813_PHATR Predicted protein OS=Phaeodactylum tricor... 35 2.5
tr|Q00YI7|Q00YI7_OSTTA Chromosome 11 contig 1, DNA sequence OS=O... 34 4.2
tr|A7SSL3|A7SSL3_NEMVE Predicted protein OS=Nematostella vectens... 34 4.2
tr|A4RGG6|A4RGG6_MAGGR Putative uncharacterized protein OS=Magna... 33 5.5
tr|A1D2N7|A1D2N7_NEOFI Putative uncharacterized protein OS=Neosa... 33 5.5
tr|Q13P26|Q13P26_BURXL Putative fatty aldehyde dehydrogenase OS=... 33 7.2
tr|Q1JTD3|Q1JTD3_TOXGO Putative uncharacterized protein OS=Toxop... 33 7.2
tr|B6KQW9|B6KQW9_TOXGO Putative uncharacterized protein OS=Toxop... 33 7.2

>tr|B8BAI4|B8BAI4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_29140 PE=4 SV=1
Length = 959

Score = 121 bits (303), Expect(2) = 6e-30
Identities = 55/129 (42%), Positives = 79/129 (61%), Gaps = 1/129 (0%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKK-ECGLE 241
RR M TN C+ FP+ LC +LV+ Q ++N L+ P + CGC C+ G C++ ECG+E
Sbjct: 34 RRNMKTNACITVFPVFLCVILVVLQGVLNHELNKPKYQCGCACVDAAPDGTCRRTECGVE 93

Query: 242 YSTPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYT 421
+ST Q C I P WPA++QVP + RA+ + F GLPD +CR G+CP S L T
Sbjct: 94 HSTLDQVGSCPIQSPTPWPALVQVPRPESRAVRIASQPFDGLPDPTCRGTGSCPASVLVT 153

Query: 422 GKSQLVANN 448
G ++ +A +
Sbjct: 154 GMNRSLAQS 162



Score = 33.1 bits (74), Expect(2) = 6e-30
Identities = 16/19 (84%), Positives = 16/19 (84%)
Frame = +3

Query: 3 ATSFATQANALLRKNLNFQ 59
A FATQANALLRKNL FQ
Sbjct: 15 AAGFATQANALLRKNLCFQ 33


>tr|Q0J5V8|Q0J5V8_ORYSJ Os08g0398300 protein OS=Oryza sativa subsp.
japonica GN=Os08g0398300 PE=3 SV=1
Length = 957

Score = 120 bits (301), Expect(2) = 1e-29
Identities = 55/129 (42%), Positives = 79/129 (61%), Gaps = 1/129 (0%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKK-ECGLE 241
RR M TN C+ FP+ LC +LV+ Q +IN ++ P + CGC C+ G C++ ECG+E
Sbjct: 32 RRNMKTNACITVFPVFLCVILVVLQGVINHEINKPKYQCGCACVDAAPDGTCRRTECGVE 91

Query: 242 YSTPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYT 421
+ST Q C I P WPA++QVP + RA+ + F GLPD +CR G+CP S L T
Sbjct: 92 HSTLDQVGSCPIKSPTPWPALVQVPRPESRAVRIASQPFDGLPDPTCRDTGSCPASVLVT 151

Query: 422 GKSQLVANN 448
G ++ +A +
Sbjct: 152 GMNRSLAQS 160



Score = 33.1 bits (74), Expect(2) = 1e-29
Identities = 16/19 (84%), Positives = 16/19 (84%)
Frame = +3

Query: 3 ATSFATQANALLRKNLNFQ 59
A FATQANALLRKNL FQ
Sbjct: 13 AAGFATQANALLRKNLCFQ 31


>tr|Q6ZIV9|Q6ZIV9_ORYSJ Putative ABC transporter (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=OJ1198_B10.14 PE=3 SV=1
Length = 929

Score = 120 bits (301), Expect(2) = 1e-29
Identities = 55/129 (42%), Positives = 79/129 (61%), Gaps = 1/129 (0%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKK-ECGLE 241
RR M TN C+ FP+ LC +LV+ Q +IN ++ P + CGC C+ G C++ ECG+E
Sbjct: 32 RRNMKTNACITVFPVFLCVILVVLQGVINHEINKPKYQCGCACVDAAPDGTCRRTECGVE 91

Query: 242 YSTPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYT 421
+ST Q C I P WPA++QVP + RA+ + F GLPD +CR G+CP S L T
Sbjct: 92 HSTLDQVGSCPIKSPTPWPALVQVPRPESRAVRIASQPFDGLPDPTCRDTGSCPASVLVT 151

Query: 422 GKSQLVANN 448
G ++ +A +
Sbjct: 152 GMNRSLAQS 160



Score = 33.1 bits (74), Expect(2) = 1e-29
Identities = 16/19 (84%), Positives = 16/19 (84%)
Frame = +3

Query: 3 ATSFATQANALLRKNLNFQ 59
A FATQANALLRKNL FQ
Sbjct: 13 AAGFATQANALLRKNLCFQ 31


>tr|A9S3Q7|A9S3Q7_PHYPA ATP-binding cassette transporter, subfamily
A, member 4, group ATH protein PpABCA4 OS=Physcomitrella
patens subsp. patens GN=ppabca4 PE=3 SV=1
Length = 981

Score = 123 bits (309), Expect(2) = 4e-29
Identities = 60/128 (46%), Positives = 78/128 (60%), Gaps = 1/128 (0%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEY 244
+R TNCCLV FP +LC LLV+ QV +N V +G CGC C+P G C + CGLEY
Sbjct: 39 KRNWRTNCCLVLFPALLCILLVIIQVAVNGVFNGSDFKCGCKCVPDPNGGPCIQRCGLEY 98

Query: 245 STPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGL-PDVSCRWWGTCPISFLYT 421
S QAV+C + P WPA+LQ+P Q+RA N+ P L D SCR GTC ++ YT
Sbjct: 99 SNNDQAVWCGMANPTPWPALLQIPEPQYRAT---RNQSPDLTQDPSCRVAGTCAVTIPYT 155

Query: 422 GKSQLVAN 445
G ++ A+
Sbjct: 156 GTNRTTAD 163



Score = 28.1 bits (61), Expect(2) = 4e-29
Identities = 13/18 (72%), Positives = 14/18 (77%)
Frame = +3

Query: 6 TSFATQANALLRKNLNFQ 59
T+ TQANAL RKNL FQ
Sbjct: 21 TAKKTQANALFRKNLTFQ 38


>tr|A7QI68|A7QI68_VITVI Chromosome chr17 scaffold_101, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000115001
PE=3 SV=1
Length = 949

Score = 120 bits (300), Expect(2) = 4e-29
Identities = 56/123 (45%), Positives = 80/123 (65%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEY 244
+R + TN LV FPI+LC LLV+ Q ++N L + CGC + TN +G +K CG++Y
Sbjct: 27 KRNIRTNIRLVSFPILLCVLLVVIQKLVNSELDKAENKCGCISV-TNENGQTEKRCGIQY 85

Query: 245 STPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTG 424
ST Q C IP PP+WPA+LQVP+ ++RA+ +F LPD SCR G+CP + L+TG
Sbjct: 86 STLDQVGTCPIPSPPEWPALLQVPAPEYRAVRADFIQFTDLPDDSCRRTGSCPATILFTG 145

Query: 425 KSQ 433
++
Sbjct: 146 NNR 148



Score = 31.6 bits (70), Expect(2) = 4e-29
Identities = 15/17 (88%), Positives = 15/17 (88%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQ 59
SF TQANALLRKNL FQ
Sbjct: 10 SFWTQANALLRKNLTFQ 26


>tr|A9SZT0|A9SZT0_PHYPA ATP-binding cassette transporter, subfamily
A, member 3, group ATH protein PpABCA3 OS=Physcomitrella
patens subsp. patens GN=ppabca3 PE=3 SV=1
Length = 943

Score = 116 bits (290), Expect(2) = 5e-27
Identities = 55/128 (42%), Positives = 76/128 (59%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEY 244
+R TN C+V FP+ LC LLV+ QV++N +L G CGC C+P C K CG+EY
Sbjct: 53 KRNWKTNSCMVCFPLTLCVLLVVIQVVVNYLL-GSDFQCGCKCVPNTGRPGCTKHCGVEY 111

Query: 245 STPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTG 424
S Q FC + P WPA+LQVP ++RA+ N P L D +CR G C + LYTG
Sbjct: 112 SNQDQVEFCEVSFPQGWPAILQVPRPEYRAV--RNAGSPELQDATCRNDGNCECTILYTG 169

Query: 425 KSQLVANN 448
++ +A++
Sbjct: 170 SNKTLADS 177



Score = 28.5 bits (62), Expect(2) = 5e-27
Identities = 12/18 (66%), Positives = 15/18 (83%)
Frame = +3

Query: 6 TSFATQANALLRKNLNFQ 59
TS+ TQA+AL RKNL +Q
Sbjct: 35 TSYRTQADALFRKNLTYQ 52


>tr|Q69XA0|Q69XA0_ORYSJ Os06g0589300 protein OS=Oryza sativa subsp.
japonica GN=P0633E08.4 PE=2 SV=1
Length = 949

Score = 115 bits (288), Expect(2) = 8e-27
Identities = 52/118 (44%), Positives = 76/118 (64%)
Frame = +2

Query: 92 LVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEYSTPAQAVFC 271
L+ PI LC LL + Q +IN VL P CGC C+ N +G C+ CG++YST QA C
Sbjct: 39 LIIVPIYLCLLLTILQRVINSVLDKPKFRCGCKCVDVNGTGSCQNVCGIQYSTLDQAGSC 98

Query: 272 AIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTGKSQLVAN 445
IP PP+WPA+LQ+P ++RA+ E ++ + G PDVSCR +C + +TG ++ ++N
Sbjct: 99 PIPNPPEWPALLQLPRPEYRAMQE-SSLYAGFPDVSCRKSQSCAATIPFTGANETLSN 155



Score = 28.5 bits (62), Expect(2) = 8e-27
Identities = 14/22 (63%), Positives = 15/22 (68%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQVIDEK 74
SF Q NALLRKNL FQ + K
Sbjct: 13 SFTAQTNALLRKNLIFQKRNRK 34


>tr|A3BD56|A3BD56_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_020978 PE=3 SV=1
Length = 844

Score = 115 bits (288), Expect(2) = 8e-27
Identities = 52/118 (44%), Positives = 76/118 (64%)
Frame = +2

Query: 92 LVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEYSTPAQAVFC 271
L+ PI LC LL + Q +IN VL P CGC C+ N +G C+ CG++YST QA C
Sbjct: 39 LIIVPIYLCLLLTILQRVINSVLDKPKFRCGCKCVDVNGTGSCQNVCGIQYSTLDQAGSC 98

Query: 272 AIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTGKSQLVAN 445
IP PP+WPA+LQ+P ++RA+ E ++ + G PDVSCR +C + +TG ++ ++N
Sbjct: 99 PIPNPPEWPALLQLPRPEYRAMQE-SSLYAGFPDVSCRKSQSCAATIPFTGANETLSN 155



Score = 28.5 bits (62), Expect(2) = 8e-27
Identities = 14/22 (63%), Positives = 15/22 (68%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQVIDEK 74
SF Q NALLRKNL FQ + K
Sbjct: 13 SFTAQTNALLRKNLIFQKRNRK 34


>tr|B8B454|B8B454_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23532 PE=4 SV=1
Length = 949

Score = 114 bits (284), Expect(2) = 2e-26
Identities = 51/118 (43%), Positives = 75/118 (63%)
Frame = +2

Query: 92 LVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGICKKECGLEYSTPAQAVFC 271
L+ PI LC LL + Q +IN VL P CGC C+ N +G C+ CG++YST QA C
Sbjct: 39 LIIVPIYLCLLLTILQRVINSVLDKPKFRCGCKCVDVNGTGSCQNVCGIQYSTLDQAGSC 98

Query: 272 AIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYTGKSQLVAN 445
IP PP+WPA+LQ+P ++RA+ E ++ + G PD SCR +C + +TG ++ ++N
Sbjct: 99 PIPNPPEWPALLQLPRPEYRAMQE-SSLYTGFPDASCRKSQSCAATIPFTGANETLSN 155



Score = 28.5 bits (62), Expect(2) = 2e-26
Identities = 14/22 (63%), Positives = 15/22 (68%)
Frame = +3

Query: 9 SFATQANALLRKNLNFQVIDEK 74
SF Q NALLRKNL FQ + K
Sbjct: 13 SFTAQTNALLRKNLIFQKRNRK 34


>tr|B8BES4|B8BES4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31047 PE=4 SV=1
Length = 927

Score = 120 bits (300), Expect = 4e-26
Identities = 54/129 (41%), Positives = 81/129 (62%), Gaps = 1/129 (0%)
Frame = +2

Query: 65 RRKMATNCCLVGFPIVLCTLLVLFQVIINKVLSGPSHSCGCTCLPTNASGIC-KKECGLE 241
RR + TN + FPI++C LLV+ Q +IN L P + CGC C ++ G C +KECG++
Sbjct: 14 RRNLKTNVGITVFPILICVLLVVLQNVINGELDKPKYQCGCECTESDLEGTCLRKECGIQ 73

Query: 242 YSTPAQAVFCAIPKPPQWPAVLQVPSSQHRAIDEHNNEFPGLPDVSCRWWGTCPISFLYT 421
+ST Q C +P PP+WPA++QVP RA+ + F LP+ CR G+CP++ L T
Sbjct: 74 HSTLEQVWSCEVPSPPRWPALIQVPWPGFRAVGTASQPFDDLPNPLCRGDGSCPVTLLVT 133

Query: 422 GKSQLVANN 448
G++Q +A +
Sbjct: 134 GENQTLAEH 142