BP913384
Clone id YMU001_000029_F07
Library
Length 435
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000029_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACACAAAACACATACTTTTGGCCAGACAGGGTAAGGTTCACCTCTTCCAAACTTGACAA
GATATTATCACAATTACTAATATGGTTTGCCACATGCTTGTAGCGCCCCCTCGAGTCTAG
AGCCACCTCTATATCGCTTACATCACATCCTTTGATTGGCACAGTCATCAAGGAAAGGCA
TTGTAGTTTGAGGTATGAAGTCACGTATGACTTTGTTCATACCATTCATCATATGTGCAA
TTGAATTAGCTTCTCCCTGAGGTAAGGTGCACATCCTTACCATGCCCAAAGGTGTCCTCA
TGGTACTCAGGTCCCTACTTTCCATTGCTAGTTGGAAGAACTGATCATACCGTGAGTACA
AATCTCCCATAGAATATATTGCTCTTATTACAAATGCCTCTGTAAATTAATCTACAACTG
GCCCTATACCCACAT
■■Homology search results ■■ -
sp_hit_id Q6UXG8
Definition sp|Q6UXG8|BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens
Align length 53
Score (bit) 32.0
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913384|Adiantum capillus-veneris mRNA, clone:
YMU001_000029_F07.
(435 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6UXG8|BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapien... 32 1.1
sp|Q6PHN7|TM164_MOUSE Transmembrane protein 164 OS=Mus musculus ... 32 1.5
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from tra... 31 1.9
sp|Q9QYJ2|RASA3_RAT Ras GTPase-activating protein 3 OS=Rattus no... 30 3.4
sp|Q60790|RASA3_MOUSE Ras GTPase-activating protein 3 OS=Mus mus... 30 3.4
sp|Q5U3C3|TM164_HUMAN Transmembrane protein 164 OS=Homo sapiens ... 30 4.4
sp|Q5EA91|TM164_BOVIN Transmembrane protein 164 OS=Bos taurus GN... 30 4.4
sp|Q63X85|FDHD_BURPS Protein fdhD homolog OS=Burkholderia pseudo... 30 4.4
sp|Q62MN2|FDHD_BURMA Protein fdhD homolog OS=Burkholderia mallei... 30 4.4
sp|Q8GMR7|SYS_SYNE7 Seryl-tRNA synthetase OS=Synechococcus elong... 29 7.5
sp|Q40255|ALDH_LINUS Probable aldehyde dehydrogenase OS=Linum us... 29 9.6
sp|Q14644|RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sa... 29 9.8
sp|Q9EPX2|PPN_MOUSE Papilin OS=Mus musculus GN=Papln PE=2 SV=1 29 9.8

>sp|Q6UXG8|BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens
GN=BTNL9 PE=2 SV=1
Length = 535

Score = 32.0 bits (71), Expect = 1.1
Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 11/53 (20%)
Frame = -2

Query: 386 KSNIFYGRFVLTV*SVLPTSNGK*GPEYHEDTF-----------GHGKDVHLT 261
K +I YG VL + S++P+ G G +H D F G G D HL+
Sbjct: 108 KDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLS 160


>sp|Q6PHN7|TM164_MOUSE Transmembrane protein 164 OS=Mus musculus
GN=Tmem164 PE=2 SV=1
Length = 296

Score = 31.6 bits (70), Expect = 1.5
Identities = 12/34 (35%), Positives = 22/34 (64%)
Frame = +1

Query: 220 YHSSYVQLN*LLPEVRCTSLPCPKVSSWYSGPYF 321
YH S++Q+ L+ EV ++ CP +S + GP++
Sbjct: 218 YHFSFLQILGLVTEVNLNNMLCPAISDPFYGPWY 251


>sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from
transposon gypsy OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1035

Score = 31.2 bits (69), Expect = 1.9
Identities = 19/67 (28%), Positives = 32/67 (47%)
Frame = -3

Query: 364 DLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEANSIAHMMNGMNKVIRDFIPQT 185
DL S Y Q + LA R+ ++ G C LP G N+ + ++ V+R+ I +
Sbjct: 277 DLKSGYHQIY-LAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDDVLREQIGKI 335

Query: 184 TMPFLDD 164
++DD
Sbjct: 336 CYVYVDD 342


>sp|Q9QYJ2|RASA3_RAT Ras GTPase-activating protein 3 OS=Rattus
norvegicus GN=Rasa3 PE=2 SV=2
Length = 834

Score = 30.4 bits (67), Expect = 3.4
Identities = 14/26 (53%), Positives = 17/26 (65%)
Frame = +1

Query: 28 QGKVHLFQT*QDIITITNMVCHMLVA 105
QGKVHL ++IT T +VCH L A
Sbjct: 124 QGKVHLELRLSEVITDTGVVCHKLAA 149


>sp|Q60790|RASA3_MOUSE Ras GTPase-activating protein 3 OS=Mus
musculus GN=Rasa3 PE=1 SV=1
Length = 834

Score = 30.4 bits (67), Expect = 3.4
Identities = 14/26 (53%), Positives = 17/26 (65%)
Frame = +1

Query: 28 QGKVHLFQT*QDIITITNMVCHMLVA 105
QGKVHL ++IT T +VCH L A
Sbjct: 124 QGKVHLELRLSEVITHTGVVCHKLAA 149


>sp|Q5U3C3|TM164_HUMAN Transmembrane protein 164 OS=Homo sapiens
GN=TMEM164 PE=1 SV=1
Length = 297

Score = 30.0 bits (66), Expect = 4.4
Identities = 12/34 (35%), Positives = 21/34 (61%)
Frame = +1

Query: 220 YHSSYVQLN*LLPEVRCTSLPCPKVSSWYSGPYF 321
YH S +Q+ L+ EV ++ CP +S + GP++
Sbjct: 219 YHFSVLQILGLVTEVNLNNMLCPAISDPFYGPWY 252


>sp|Q5EA91|TM164_BOVIN Transmembrane protein 164 OS=Bos taurus
GN=TMEM164 PE=2 SV=1
Length = 258

Score = 30.0 bits (66), Expect = 4.4
Identities = 12/34 (35%), Positives = 21/34 (61%)
Frame = +1

Query: 220 YHSSYVQLN*LLPEVRCTSLPCPKVSSWYSGPYF 321
YH S +Q+ L+ EV ++ CP +S + GP++
Sbjct: 180 YHFSILQILGLVTEVNLNNMLCPAISDPFYGPWY 213


>sp|Q63X85|FDHD_BURPS Protein fdhD homolog OS=Burkholderia
pseudomallei GN=fdhD PE=3 SV=1
Length = 274

Score = 30.0 bits (66), Expect = 4.4
Identities = 15/45 (33%), Positives = 23/45 (51%)
Frame = -1

Query: 153 KGCDVSDIEVALDSRGRYKHVANHISNCDNILSSLEEVNLTLSGQ 19
+G DV DIEVAL G H ++ ++L+E L+G+
Sbjct: 73 RGSDVKDIEVALHGAGPLPHAEVQLTVVQQAFAALKEKRRALAGR 117


>sp|Q62MN2|FDHD_BURMA Protein fdhD homolog OS=Burkholderia mallei
GN=fdhD PE=3 SV=1
Length = 274

Score = 30.0 bits (66), Expect = 4.4
Identities = 15/45 (33%), Positives = 23/45 (51%)
Frame = -1

Query: 153 KGCDVSDIEVALDSRGRYKHVANHISNCDNILSSLEEVNLTLSGQ 19
+G DV DIEVAL G H ++ ++L+E L+G+
Sbjct: 73 RGSDVKDIEVALHGAGPLPHAEVQLTVVQQAFAALKEKRRALAGR 117


>sp|Q8GMR7|SYS_SYNE7 Seryl-tRNA synthetase OS=Synechococcus
elongatus (strain PCC 7942) GN=serS PE=3 SV=4
Length = 428

Score = 29.3 bits (64), Expect = 7.5
Identities = 15/40 (37%), Positives = 23/40 (57%)
Frame = -1

Query: 135 DIEVALDSRGRYKHVANHISNCDNILSSLEEVNLTLSGQK 16
DIEV L S GRY+ +++ SNC + + + +GQK
Sbjct: 339 DIEVWLPSAGRYREISS-CSNCGDFQARRANIRFKEAGQK 377


tr_hit_id A9TQU7
Definition tr|A9TQU7|A9TQU7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 87
Score (bit) 91.3
E-value 5.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913384|Adiantum capillus-veneris mRNA, clone:
YMU001_000029_F07.
(435 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TQU7|A9TQU7_PHYPA Predicted protein OS=Physcomitrella paten... 91 5e-18
tr|A9RDE1|A9RDE1_PHYPA Predicted protein OS=Physcomitrella paten... 87 5e-16
tr|B3GGB9|B3GGB9_PODAN Gag-pol polyprotein OS=Podospora anserina... 84 3e-15
tr|A9RFA7|A9RFA7_PHYPA Predicted protein (Fragment) OS=Physcomit... 78 2e-13
tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein OS=Botry... 72 1e-11
tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein OS=Botry... 72 1e-11
tr|A8PI98|A8PI98_COPC7 Putative uncharacterized protein OS=Copri... 71 3e-11
tr|Q1DH77|Q1DH77_COCIM Putative uncharacterized protein OS=Cocci... 66 2e-10
tr|A8PDI4|A8PDI4_COPC7 Putative uncharacterized protein OS=Copri... 61 3e-08
tr|A8NJA8|A8NJA8_COPC7 Putative uncharacterized protein OS=Copri... 61 3e-08
tr|A8NJB5|A8NJB5_COPC7 Putative uncharacterized protein OS=Copri... 59 2e-07
tr|Q1DTQ2|Q1DTQ2_COCIM Putative uncharacterized protein OS=Cocci... 58 3e-07
tr|Q1WVZ6|Q1WVZ6_COCIM Putative uncharacterized protein OS=Cocci... 55 3e-07
tr|Q9C0U1|Q9C0U1_YARLI YALI0A10395p OS=Yarrowia lipolytica GN=ta... 54 3e-06
tr|Q6CHG3|Q6CHG3_YARLI YALI0A08932p OS=Yarrowia lipolytica GN=YA... 54 3e-06
tr|Q6CFJ9|Q6CFJ9_YARLI YALI0B06303p OS=Yarrowia lipolytica GN=YA... 54 3e-06
tr|Q6CFJ4|Q6CFJ4_YARLI YALI0B06446p OS=Yarrowia lipolytica GN=YA... 54 3e-06
tr|Q6C613|Q6C613_YARLI YALI0E13376p OS=Yarrowia lipolytica GN=YA... 54 3e-06
tr|Q6C3G7|Q6C3G7_YARLI YALI0E34980p OS=Yarrowia lipolytica GN=YA... 54 3e-06
tr|Q1EBN1|Q1EBN1_COCIM Putative uncharacterized protein OS=Cocci... 54 3e-06
tr|Q1E3K7|Q1E3K7_COCIM Putative uncharacterized protein OS=Cocci... 49 3e-06
tr|Q1DWI5|Q1DWI5_COCIM Putative uncharacterized protein OS=Cocci... 49 5e-06
tr|Q1DUS7|Q1DUS7_COCIM Putative uncharacterized protein OS=Cocci... 52 1e-05
tr|Q1DKB7|Q1DKB7_COCIM Putative uncharacterized protein OS=Cocci... 52 1e-05
tr|Q1DV77|Q1DV77_COCIM Putative uncharacterized protein OS=Cocci... 52 1e-05
tr|A8N7Z6|A8N7Z6_COPC7 Putative uncharacterized protein OS=Copri... 52 1e-05
tr|Q1DXX7|Q1DXX7_COCIM Putative uncharacterized protein OS=Cocci... 51 3e-05
tr|Q1DRW1|Q1DRW1_COCIM Putative uncharacterized protein OS=Cocci... 50 6e-05
tr|Q1DLK6|Q1DLK6_COCIM Putative uncharacterized protein OS=Cocci... 49 9e-05
tr|Q1DID1|Q1DID1_COCIM Putative uncharacterized protein OS=Cocci... 49 1e-04

>tr|A9TQU7|A9TQU7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_149159 PE=4 SV=1
Length = 138

Score = 91.3 bits (225), Expect(2) = 5e-18
Identities = 45/87 (51%), Positives = 64/87 (73%)
Frame = -3

Query: 427 IGPVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEA 248
+G +VD E FV AIYS+ DLYSRYDQF QLA E+RDL+TM+TP G+++M LP G
Sbjct: 3 LGLIVDEVAEKFVSHAIYSIEDLYSRYDQF-QLAKENRDLTTMKTPFGLMKMYILPLGVT 61

Query: 247 NSIAHMMNGMNKVIRDFIPQTTMPFLD 167
N +AH+ N +N+++++FI + + FLD
Sbjct: 62 NLVAHIKNTINQILKEFILKKIILFLD 88



Score = 23.5 bits (49), Expect(2) = 5e-18
Identities = 12/40 (30%), Positives = 19/40 (47%)
Frame = -1

Query: 135 DIEVALDSRGRYKHVANHISNCDNILSSLEEVNLTLSGQK 16
D + + G K + HI + I L+ VNLT+ +K
Sbjct: 99 DKDETIKVEGCRKFIKRHIEDVARIFERLKSVNLTIILEK 138


>tr|A9RDE1|A9RDE1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64601 PE=4 SV=1
Length = 162

Score = 86.7 bits (213), Expect = 5e-16
Identities = 47/68 (69%), Positives = 53/68 (77%), Gaps = 1/68 (1%)
Frame = -3

Query: 430 GIG-PVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQG 254
G+G PVVD E FV AIYS GDLYS DQF QLA ESRDL+TM+TPLG++RMCTL QG
Sbjct: 96 GMGSPVVDEVVEQFVRHAIYSTGDLYSGSDQF-QLAKESRDLTTMKTPLGLMRMCTLLQG 154

Query: 253 EANSIAHM 230
NS+AHM
Sbjct: 155 ATNSVAHM 162


>tr|B3GGB9|B3GGB9_PODAN Gag-pol polyprotein OS=Podospora anserina PE=4
SV=1
Length = 2603

Score = 84.3 bits (207), Expect = 3e-15
Identities = 43/90 (47%), Positives = 57/90 (63%)
Frame = -3

Query: 427 IGPVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEA 248
I P + F+E F I S+ D +S YDQ +LA+ SRDL+T TP+G+ RMCTLPQG
Sbjct: 1641 IPPSTEEFSEDFAGCLITSLLDFFSGYDQV-KLALTSRDLTTFATPIGLFRMCTLPQGAT 1699

Query: 247 NSIAHMMNGMNKVIRDFIPQTTMPFLDDCA 158
NS+A + +V +D IPQ P+LDD A
Sbjct: 1700 NSVAQFQRAVTRVFQDLIPQVCRPYLDDIA 1729


>tr|A9RFA7|A9RFA7_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_113296 PE=4 SV=1
Length = 52

Score = 78.2 bits (191), Expect = 2e-13
Identities = 35/49 (71%), Positives = 42/49 (85%)
Frame = -3

Query: 310 LSTMRTPLGMVRMCTLPQGEANSIAHMMNGMNKVIRDFIPQTTMPFLDD 164
++ M+TPLG+VRMCTLPQG NSI HMMN MNKV+RDFI + TMPFL+D
Sbjct: 1 MTIMKTPLGLVRMCTLPQGATNSIMHMMNEMNKVLRDFILKKTMPFLND 49


>tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_12337
PE=4 SV=1
Length = 1114

Score = 72.4 bits (176), Expect = 1e-11
Identities = 38/86 (44%), Positives = 51/86 (59%)
Frame = -3

Query: 421 PVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEANS 242
P D F E F + S+ D +S YDQ LA+ESRDL+ +TPLG++R TLPQG NS
Sbjct: 195 PDADAFAENFAGCTVASLIDFFSGYDQI-PLALESRDLTAFQTPLGLLRYTTLPQGATNS 253

Query: 241 IAHMMNGMNKVIRDFIPQTTMPFLDD 164
+A + K++ D P + FLDD
Sbjct: 254 VAQFCRIIMKILGDLTPSVAISFLDD 279


>tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_02171
PE=4 SV=1
Length = 1114

Score = 72.4 bits (176), Expect = 1e-11
Identities = 38/86 (44%), Positives = 51/86 (59%)
Frame = -3

Query: 421 PVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEANS 242
P D F E F + S+ D +S YDQ LA+ESRDL+ +TPLG++R TLPQG NS
Sbjct: 195 PDADAFAENFAGCTVASLIDFFSGYDQI-PLALESRDLTAFQTPLGLLRYTTLPQGATNS 253

Query: 241 IAHMMNGMNKVIRDFIPQTTMPFLDD 164
+A + K++ D P + FLDD
Sbjct: 254 VAQFCRIIMKILGDLTPSVAISFLDD 279


>tr|A8PI98|A8PI98_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_13271 PE=4 SV=1
Length = 1047

Score = 70.9 bits (172), Expect = 3e-11
Identities = 37/86 (43%), Positives = 53/86 (61%)
Frame = -3

Query: 421 PVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEANS 242
P ++ + E+F RA YS DL+ YDQ L SRDL++ +TPLG +R+ +P G NS
Sbjct: 145 PQIEPYAESFGGRACYSTFDLFVGYDQRL-LHPNSRDLTSFQTPLGTLRLTRIPMGYTNS 203

Query: 241 IAHMMNGMNKVIRDFIPQTTMPFLDD 164
+ + +V+RD IP TMPF+DD
Sbjct: 204 LQIQQGDLTEVLRDEIPDWTMPFVDD 229


>tr|Q1DH77|Q1DH77_COCIM Putative uncharacterized protein
OS=Coccidioides immitis GN=CIMG_10336 PE=4 SV=1
Length = 436

Score = 65.9 bits (159), Expect(2) = 2e-10
Identities = 37/94 (39%), Positives = 55/94 (58%)
Frame = -3

Query: 427 IGPVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGEA 248
I P VD +TE F + S+ DL+S YD F LA ESRD++ + TP+G+ TL QG
Sbjct: 251 IPPNVDKYTEDFSRLVMASLCDLFSGYDNF-PLAKESRDMTAIATPIGLFCHTTLVQGAT 309

Query: 247 NSIAHMMNGMNKVIRDFIPQTTMPFLDDCANQRM 146
NS A + + K+I++ P+ F+DD +R+
Sbjct: 310 NSPAQAQHRIMKIIQEVFPEIAQAFMDDLEVKRL 343



Score = 23.1 bits (48), Expect(2) = 2e-10
Identities = 11/33 (33%), Positives = 17/33 (51%)
Frame = -1

Query: 99 KHVANHISNCDNILSSLEEVNLTLSGQKYVFCV 1
+ V NH+ N D IL ++ +S K FC+
Sbjct: 357 RFVYNHLQNLDYILWLVKISGARISSAKSQFCM 389


>tr|A8PDI4|A8PDI4_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_09492 PE=4 SV=1
Length = 1030

Score = 60.8 bits (146), Expect = 3e-08
Identities = 33/89 (37%), Positives = 50/89 (56%)
Frame = -3

Query: 430 GIGPVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGE 251
GI P + F RA DL+ YD+ +L ESRDL+T +TP G +R+ TLP G
Sbjct: 770 GIPPATEELAARFAGRACGGCMDLFVGYDER-ELHPESRDLTTFQTPFGALRIVTLPMGW 828

Query: 250 ANSIAHMMNGMNKVIRDFIPQTTMPFLDD 164
NS+ + + +++ IP T+P++DD
Sbjct: 829 TNSVPIFHDDVTFILQPEIPHVTIPYIDD 857


>tr|A8NJA8|A8NJA8_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_13173 PE=4 SV=1
Length = 426

Score = 60.8 bits (146), Expect = 3e-08
Identities = 33/89 (37%), Positives = 50/89 (56%)
Frame = -3

Query: 430 GIGPVVD*FTEAFVIRAIYSMGDLYSRYDQFFQLAMESRDLSTMRTPLGMVRMCTLPQGE 251
GI P + F RA DL+ YD+ +L ESRDL+T +TP G +R+ TLP G
Sbjct: 174 GIPPATEELAARFAGRACGGCMDLFVGYDER-ELHPESRDLTTFQTPFGALRIVTLPMGW 232

Query: 250 ANSIAHMMNGMNKVIRDFIPQTTMPFLDD 164
NS+ + + +++ IP T+P++DD
Sbjct: 233 TNSVPIFHDDVTFILQPEIPHVTIPYIDD 261