BP913391
Clone id YMU001_000029_G02
Library
Length 500
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000029_G02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AATTCGCGGCCGCGAATTGCGAAGGTGACAAGAGCATGATGCTCAAGAACCTAGAGAATC
TGAGGAGCGGAATGCTCGAGATACTTCAGAACCCAGAAGACATCCATGAACATCAATCCA
GAACCATAGCCAAGAAATCCCGTCATTTCGGTGAGGATATGAAGGTCTTTAGACCTCAGA
ACCCTCCGGTCAAGTTTGATACTTGTGACGGAAGGGAAGATGTCCTGAAAGCTACCGCTA
TCATTCGACAGTATGAAGTTGCCTTTGCAAATGGCAATTTTTGAGAAGCGTCAAAGGTGA
GGCATGTGACCAAACAACTCAAGGGGATTGCAAGTATTTGGTGGTATACCAAGGCTCTGC
AAGGAACTTACAACAAGACTTGGATTCAATTCAAGGCTGAATTTTCCGACAATTTTGTTT
CCTCTACGCTTTGAGGAGGGCATCCAAGAAGATTGGGATTGGTTTGCCGAATAGGAACAC
GAGTGAGTCAAAGCAACCAG
■■Homology search results ■■ -
sp_hit_id Q9VPC0
Definition sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster
Align length 77
Score (bit) 30.8
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913391|Adiantum capillus-veneris mRNA, clone:
YMU001_000029_G02.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=... 31 3.1
sp|A1KSP4|ARLY_NEIMF Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|Q9K0G8|ARLY_NEIMB Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|Q9JVG7|ARLY_NEIMA Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|A9M2R4|ARLY_NEIM0 Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|A4VJR9|GLND_PSEU5 [Protein-PII] uridylyltransferase OS=Pseudo... 30 6.8
sp|P11619|NEP_I83A1 Nuclear export protein OS=Influenza A virus ... 29 8.9
sp|Q4ZWT0|GLND_PSEU2 [Protein-PII] uridylyltransferase OS=Pseudo... 29 8.9
sp|Q886P5|GLND_PSESM [Protein-PII] uridylyltransferase OS=Pseudo... 29 8.9

>sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE
OS=Drosophila melanogaster GN=Pitslre PE=1 SV=1
Length = 952

Score = 30.8 bits (68), Expect = 3.1
Identities = 20/77 (25%), Positives = 41/77 (53%)
Frame = +3

Query: 3 EGDKSMMLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 182
E ++++ + +N ++E+L +PE H HQ + + +S+ + E+++V R + P +
Sbjct: 235 ERERTVRSTHKQNRHDRVIELLDSPEQEHHHQHQHKSHRSK-WREEVEVIR-RKVPEDLE 292

Query: 183 TCDGREDVLKATAIIRQ 233
RE +L A RQ
Sbjct: 293 LLARREKLLAAERESRQ 309


>sp|A1KSP4|ARLY_NEIMF Argininosuccinate lyase OS=Neisseria
meningitidis serogroup C / serotype 2a (strain ATCC
700532 / FAM18) GN=argH PE=3 SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = +3

Query: 21 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 182
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|Q9K0G8|ARLY_NEIMB Argininosuccinate lyase OS=Neisseria
meningitidis serogroup B GN=argH PE=3 SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = +3

Query: 21 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 182
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|Q9JVG7|ARLY_NEIMA Argininosuccinate lyase OS=Neisseria
meningitidis serogroup A GN=argH PE=3 SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = +3

Query: 21 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 182
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|A9M2R4|ARLY_NEIM0 Argininosuccinate lyase OS=Neisseria
meningitidis serogroup C (strain 053442) GN=argH PE=3
SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = +3

Query: 21 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 182
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|A4VJR9|GLND_PSEU5 [Protein-PII] uridylyltransferase
OS=Pseudomonas stutzeri (strain A1501) GN=glnD PE=3 SV=1
Length = 900

Score = 29.6 bits (65), Expect = 6.8
Identities = 11/35 (31%), Positives = 22/35 (62%)
Frame = +3

Query: 27 KNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHF 131
+ +E +RSG++ L+NP+D R + ++ +HF
Sbjct: 764 ERIEEIRSGLIAALRNPDDYLTIIQRRVPRQLKHF 798


>sp|P11619|NEP_I83A1 Nuclear export protein OS=Influenza A virus
(strain A/Chile/1/1983 H1N1) GN=NS PE=3 SV=1
Length = 121

Score = 29.3 bits (64), Expect = 8.9
Identities = 20/77 (25%), Positives = 31/77 (40%), Gaps = 5/77 (6%)
Frame = -2

Query: 269 FSKIAICKGNFILSNDSGSFQDIFPSVTSIKLDR-----RVLRSKDLHILTEMTGFLGYG 105
F I + L + SG + S+KL R V+R DLH L G
Sbjct: 9 FQDILMRMSKMQLGSSSGDLNGMITQFESLKLYRDSLGEAVMRMGDLHSLQNRNGKWREQ 68

Query: 104 SGLMFMDVFWVLKYLEH 54
G F ++ W+++ + H
Sbjct: 69 LGQKFEEIRWLIEEVRH 85


>sp|Q4ZWT0|GLND_PSEU2 [Protein-PII] uridylyltransferase
OS=Pseudomonas syringae pv. syringae (strain B728a)
GN=glnD PE=3 SV=1
Length = 898

Score = 29.3 bits (64), Expect = 8.9
Identities = 13/45 (28%), Positives = 25/45 (55%)
Frame = +3

Query: 27 KNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQ 161
+ ++++R G+ E L+NP+D R + ++ +HF F PQ
Sbjct: 763 ERIQDIREGLTEALRNPDDYPTIIKRRVPRQLKHF-----AFAPQ 802


>sp|Q886P5|GLND_PSESM [Protein-PII] uridylyltransferase
OS=Pseudomonas syringae pv. tomato GN=glnD PE=3 SV=1
Length = 898

Score = 29.3 bits (64), Expect = 8.9
Identities = 13/45 (28%), Positives = 25/45 (55%)
Frame = +3

Query: 27 KNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQ 161
+ ++++R G+ E L+NP+D R + ++ +HF F PQ
Sbjct: 763 ERIQDIRDGLTEALRNPDDYPTIIKRRVPRQLKHF-----AFAPQ 802


tr_hit_id Q4QXS8
Definition tr|Q4QXS8|Q4QXS8_HORVD Polyprotein OS=Hordeum vulgare var. distichum
Align length 117
Score (bit) 40.8
E-value 0.034
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913391|Adiantum capillus-veneris mRNA, clone:
YMU001_000029_G02.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4QXS8|Q4QXS8_HORVD Polyprotein OS=Hordeum vulgare var. disti... 41 0.034
tr|Q8LLB6|Q8LLB6_HORVU Sukkula-1b polyprotein OS=Hordeum vulgare... 40 0.045
tr|Q8LLB4|Q8LLB4_HORVU Sukkula-1a polyprotein OS=Hordeum vulgare... 40 0.045
tr|Q2R193|Q2R193_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.13
tr|Q2QR60|Q2QR60_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.13
tr|Q0ZLH4|Q0ZLH4_9ORYZ Polyprotein OS=Oryza australiensis PE=4 SV=1 39 0.13
tr|Q2QTW2|Q2QTW2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 38 0.22
tr|Q7XUA3|Q7XUA3_ORYSJ OSJNBa0019D11.8 protein OS=Oryza sativa s... 37 0.38
tr|Q01I31|Q01I31_ORYSA OSIGBa0145G11.8 protein OS=Oryza sativa G... 37 0.38
tr|Q7G774|Q7G774_ORYSJ Putative polyprotein (Retrotransposon pro... 37 0.65
tr|Q53J53|Q53J53_ORYSJ Retrotransposon protein, putative, Ty3-gy... 36 0.85
tr|Q01M74|Q01M74_ORYSA H0616A11.5 protein OS=Oryza sativa GN=H06... 36 0.85
tr|B4FMK6|B4FMK6_MAIZE Putative uncharacterized protein OS=Zea m... 36 0.85
tr|Q7XUI0|Q7XUI0_ORYSJ OSJNBa0020J04.2 protein OS=Oryza sativa s... 36 1.1
tr|Q2R1L3|Q2R1L3_ORYSJ Retrotransposon protein, putative, Ty3-gy... 36 1.1
tr|Q7Y004|Q7Y004_ORYSJ Putative polyprotein (Retrotransposon pro... 35 1.4
tr|Q7XKY8|Q7XKY8_ORYSJ OSJNBa0022F16.16 protein OS=Oryza sativa ... 35 1.9
tr|Q2R3T2|Q2R3T2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 1.9
tr|Q4RQT6|Q4RQT6_TETNG Chromosome 2 SCAF15004, whole genome shot... 35 2.5
tr|Q10G32|Q10G32_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 2.5
tr|A5JSC4|A5JSC4_MAIZE Polyprotein OS=Zea mays PE=4 SV=1 35 2.5
tr|Q852G2|Q852G2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.2
tr|Q7F2E9|Q7F2E9_ORYSJ Putative polyprotein OS=Oryza sativa subs... 34 3.2
tr|Q6F330|Q6F330_ORYSJ Putative polyprotein OS=Oryza sativa subs... 34 3.2
tr|Q5JPW2|Q5JPW2_ORYSA OSJNBa0085C10.29 protein OS=Oryza sativa ... 34 3.2
tr|Q2R4W2|Q2R4W2_ORYSJ Retrotransposon, putative, centromere-spe... 34 3.2
tr|Q2QQZ1|Q2QQZ1_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.2
tr|Q10JR0|Q10JR0_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.2
tr|Q84KB1|Q84KB1_CUCME Gag-protease polyprotein OS=Cucumis melo ... 34 4.2
tr|Q8H861|Q8H861_ORYSJ Putative polyprotein OS=Oryza sativa subs... 33 5.5

>tr|Q4QXS8|Q4QXS8_HORVD Polyprotein OS=Hordeum vulgare var.
distichum PE=4 SV=1
Length = 1486

Score = 40.8 bits (94), Expect = 0.034
Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
Frame = +3

Query: 63 ILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEV 242
+LQ ++ HQ + HF + N P F +CD D A IR
Sbjct: 52 LLQLIQERANHQQGNFQQGGNHFASLSQFL--SNQPRTFTSCDQPFD---AEDWIRDMNK 106

Query: 243 AFANGNF*EASKVRHVTKQLKGIASIWW-YTKALQGTYNKTWIQFKAEFSDNFVSST 410
N V+ T QLKG ASIWW + K +G +W +F +F +++ S+
Sbjct: 107 HSECSNVRPEDYVKFATFQLKGQASIWWQHLKDSRGGRVMSWDEFCRDFRSHYIPSS 163


>tr|Q8LLB6|Q8LLB6_HORVU Sukkula-1b polyprotein OS=Hordeum vulgare
PE=4 SV=1
Length = 685

Score = 40.4 bits (93), Expect = 0.045
Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
Frame = +3

Query: 162 NPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKGIASIWW-YTKA 338
N P F +CD D A IR F N V+ T QLKG ASIWW K
Sbjct: 84 NQPKTFTSCDQPFD---AEDWIRDMNKHFECSNVRPEDYVKFATFQLKGQASIWWQQLKD 140

Query: 339 LQGTYNKTWIQFKAEFSDNFVSST 410
+G +W +F +F +++ S+
Sbjct: 141 SRGARVMSWEEFCRDFRSHYIPSS 164


>tr|Q8LLB4|Q8LLB4_HORVU Sukkula-1a polyprotein OS=Hordeum vulgare
PE=4 SV=1
Length = 685

Score = 40.4 bits (93), Expect = 0.045
Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
Frame = +3

Query: 162 NPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKGIASIWW-YTKA 338
N P F +CD D A IR F N V+ T QLKG ASIWW K
Sbjct: 84 NQPKTFTSCDQPFD---AEDWIRDMNKHFECSNVRPEDYVKFATFQLKGQASIWWQQLKD 140

Query: 339 LQGTYNKTWIQFKAEFSDNFVSST 410
+G +W +F +F +++ S+
Sbjct: 141 SRGARVMSWEEFCRDFRSHYIPSS 164


>tr|Q2R193|Q2R193_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os11g39950 PE=4 SV=1
Length = 1712

Score = 38.9 bits (89), Expect = 0.13
Identities = 32/98 (32%), Positives = 43/98 (43%), Gaps = 3/98 (3%)
Frame = +3

Query: 129 FGEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 308
FGE M+ P F T E+ + A +R E EA KV QL+G
Sbjct: 389 FGEFMRT-----KPPTFATA---EEPMDAEDCLRVIEKKLTLVRVREADKVIFAANQLEG 440

Query: 309 IASIWW--YTKALQ-GTYNKTWIQFKAEFSDNFVSSTL 413
A WW Y +A + G TW +F A F +NFV + +
Sbjct: 441 PAGDWWDTYKEAREDGAGEPTWEEFTAAFRENFVPAAV 478


>tr|Q2QR60|Q2QR60_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g28690 PE=4 SV=1
Length = 1470

Score = 38.9 bits (89), Expect = 0.13
Identities = 32/98 (32%), Positives = 44/98 (44%), Gaps = 3/98 (3%)
Frame = +3

Query: 129 FGEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 308
FGE M+ P F T D + ++A +R E EA KV QL+G
Sbjct: 48 FGEFMRT-----KPPTFATAD---EPMEAEDWLRIIEKKLTLVRVREADKVIFAVNQLEG 99

Query: 309 IASIWW--YTKALQ-GTYNKTWIQFKAEFSDNFVSSTL 413
A WW Y +A + G TW +F A F +NFV + +
Sbjct: 100 PAGDWWDTYKEAREDGAGEPTWEEFTAAFRENFVPTAV 137


>tr|Q0ZLH4|Q0ZLH4_9ORYZ Polyprotein OS=Oryza australiensis PE=4 SV=1
Length = 1469

Score = 38.9 bits (89), Expect = 0.13
Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 3/97 (3%)
Frame = +3

Query: 132 GEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKGI 311
G + F PP F T E+ + A +R E EA +V T QL+G
Sbjct: 45 GSSLGEFMRAKPPT-FSTA---EEPMDAEDWLRVIEKKLTLVRVREADRVVFATNQLEGP 100

Query: 312 ASIWWYT---KALQGTYNKTWIQFKAEFSDNFVSSTL 413
AS WW T + TW +F A F +NFV + +
Sbjct: 101 ASDWWDTYKETRAEDAGEPTWEEFTAAFRENFVPAAV 137


>tr|Q2QTW2|Q2QTW2_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g18320 PE=4 SV=1
Length = 1226

Score = 38.1 bits (87), Expect = 0.22
Identities = 31/102 (30%), Positives = 44/102 (43%), Gaps = 3/102 (2%)
Frame = +3

Query: 117 KSRHFGEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTK 296
+ H G F PP F T D + ++A +R E EA KV
Sbjct: 40 QGNHEGSSFGEFMSTKPPT-FTTTD---EPMEAEDWLRIIEKKLTLIRVREADKVIFAVN 95

Query: 297 QLKGIASIWW--YTKALQGTYNK-TWIQFKAEFSDNFVSSTL 413
QL+G A WW Y +A + + TW +F A F +NFV + +
Sbjct: 96 QLEGPAGDWWDTYKEAREEDAGEPTWEEFTAAFRENFVPAAV 137


>tr|Q7XUA3|Q7XUA3_ORYSJ OSJNBa0019D11.8 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0019D11.8 PE=4 SV=1
Length = 1470

Score = 37.4 bits (85), Expect = 0.38
Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 3/98 (3%)
Frame = +3

Query: 129 FGEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 308
FGE M+ P F T D + ++A +R E EA KV QL+G
Sbjct: 48 FGEFMRT-----KPPTFATAD---EPMEAEDWLRIIEKKLTLVRVREADKVIFAVNQLEG 99

Query: 309 IASIWW--YTKALQ-GTYNKTWIQFKAEFSDNFVSSTL 413
A WW Y +A + G TW +F F +NFV + +
Sbjct: 100 PAGDWWDTYKEAREDGAGEPTWEEFTVAFRENFVPAAV 137


>tr|Q01I31|Q01I31_ORYSA OSIGBa0145G11.8 protein OS=Oryza sativa
GN=OSIGBa0145G11.8 PE=4 SV=1
Length = 1470

Score = 37.4 bits (85), Expect = 0.38
Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 3/98 (3%)
Frame = +3

Query: 129 FGEDMKVFRPQNPPVKFDTCDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 308
FGE M+ P F T D + ++A +R E EA KV QL+G
Sbjct: 48 FGEFMRT-----KPPTFATAD---EPMEAEDWLRIIEKKLTLVRVREADKVIFAVNQLEG 99

Query: 309 IASIWW--YTKALQ-GTYNKTWIQFKAEFSDNFVSSTL 413
A WW Y +A + G TW +F F +NFV + +
Sbjct: 100 PAGDWWDTYKEAREDGAGEPTWEEFTVAFRENFVPAAV 137


>tr|Q7G774|Q7G774_ORYSJ Putative polyprotein (Retrotransposon
protein, putative, Ty3-gypsy subclass) OS=Oryza sativa
subsp. japonica GN=OSJNBa0034B05.13 PE=4 SV=1
Length = 1569

Score = 36.6 bits (83), Expect = 0.65
Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)
Frame = +3

Query: 267 EASKVRHVTKQLKGIASIWW--YTKALQGTYNK-TWIQFKAEFSDNFVSSTL 413
EA KV V QL+G A WW Y +A + + TW +F A F +NFV + +
Sbjct: 297 EADKVIFVVNQLEGPAGDWWDTYKEAREEDAGEPTWEEFTAAFHENFVPAAV 348