BP913420
Clone id YMU001_000030_A09
Library
Length 513
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TACATAGCTCCAACTTTTAAATCAGGCACGTTTTATCATGAGCAGGAAAACAAGGCATTT
CCTCTTTATTTTGCCTCATAATTGCTGTGGTTTTCAGCTATTTGACCGTGACCATTGTAC
CGTAACTATTTAGTTGACAGTAGAATTGTCTTCTTCCATGGTACATATTCCAGAAGGTGA
ATGCAATAAAGTCATATCTGGAAACCTACAACTCAAAGGGTGTAAATCCCCGGGGGCTTA
TTGAATAGATTGTCCACAATTCAGAAGAAAAATCAAGCTAGCGCATCAAAAGCAGAACAT
CAACAGTCCAGATAATTAGGCATGAAACTGAAATTCTCCAGGTATTGCAACACACAGCAC
ACGCACACAAGCAGACAGCTCCTCAATGCGAACTGCGAAACCATTTACAGCACAGCAAGC
CCAAGCACTGCCCATCTGCTCTTCCCACCTGGAGAACCATGCTGTAATCTGAAGCCACAC
ATGCAAGGTTAGTCGAGCCCTCCCGTCAAGTCA
■■Homology search results ■■ -
sp_hit_id Q8IVF4
Definition sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sapiens
Align length 71
Score (bit) 29.6
E-value 8.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913420|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_A09.
(500 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sa... 30 8.2

>sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sapiens
GN=DNAH10 PE=2 SV=3
Length = 4471

Score = 29.6 bits (65), Expect = 8.2
Identities = 19/71 (26%), Positives = 34/71 (47%)
Frame = +2

Query: 14 LLNQARFIMSRKTRHFLFILPHNCCGFQLFDRDHCTVTI*LTVELSSSMVHIPEGECNKV 193
L+ + R IM T I H C G LF+R + +T+++ + +P+ E +
Sbjct: 3696 LMKRLRNIMDTLT---FSIYNHGCTG--LFERHKLLFSFNMTIKIEQAEGRVPQEELDFF 3750

Query: 194 ISGNLQLKGCK 226
+ GN+ L+ K
Sbjct: 3751 LKGNISLEKSK 3761


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913420|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_A09.
(500 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******