BP913423
Clone id YMU001_000030_A12
Library
Length 386
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGTGTCCAAAGAAATGTCATCTTCGATTGGATCCTACAGCCGAGTATTCCTCTATATGA
TTTGGAGAATCACTGTAGCTTTCCTTTTCCTCGGTACCACCATTGTCGCGATGTCCCAAC
TTGTTGTTCCATCTGAGGCAGAGTCTCATCTTGTATTAGTTCCTGCTTCCTGTTGCATAG
GAATCATAGAAGCACCACTTGCAGCACACTCAACCTCAGCGGACACCCATTCTGGCCCTT
GTTCAATCTGAACAGGGCCATTACTATCTGCTAAATTCTCTACATTTTCAATGCTGTCCA
TAGAAGCAACATCGGCAAAGCACTCACCCTCATTTGATCCTGCAACTGGCTCTTGCTCTA
CTTGAGCTTGTGTCTCACCTTCGGCT
■■Homology search results ■■ -
sp_hit_id Q91WC3
Definition sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus
Align length 62
Score (bit) 35.0
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913423|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_A12.
(386 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus... 35 0.12
sp|Q6N4D3|SYT_RHOPA Threonyl-tRNA synthetase OS=Rhodopseudomonas... 34 0.26
sp|Q54Z20|CUPJ_DICDI Putative calcium up-regulated protein J OS=... 32 0.76
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattu... 31 2.2
sp|Q5AL27|AKR1_CANAL Palmitoyltransferase AKR1 OS=Candida albica... 30 2.9
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Hom... 29 6.5
sp|Q9P217|ZSWM5_HUMAN Zinc finger SWIM domain-containing protein... 29 8.4
sp|Q7VUZ9|Y2916_BORPE UPF0234 protein BP2916 OS=Bordetella pertu... 29 8.4
sp|Q7WMU0|Y1300_BORBR UPF0234 protein BB1300 OS=Bordetella bronc... 29 8.4
sp|P44140|Y1254_HAEIN Uncharacterized protein HI1254 OS=Haemophi... 29 8.4
sp|Q7WBC1|Y1084_BORPA UPF0234 protein BPP1084 OS=Bordetella para... 29 8.4
sp|Q9WX75|BCSA5_ACEXY Putative cellulose synthase 3 OS=Acetobact... 29 8.4
sp|Q9RBJ2|BCSA4_ACEXY Putative cellulose synthase 2 OS=Acetobact... 29 8.4
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus... 29 8.4
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cav... 29 8.4

>sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus
musculus GN=Acsl6 PE=2 SV=1
Length = 697

Score = 35.0 bits (79), Expect = 0.12
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 158 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>sp|Q6N4D3|SYT_RHOPA Threonyl-tRNA synthetase OS=Rhodopseudomonas
palustris GN=thrS PE=3 SV=1
Length = 658

Score = 33.9 bits (76), Expect = 0.26
Identities = 18/42 (42%), Positives = 25/42 (59%)
Frame = -2

Query: 130 GTTSWDIATMVVPRKRKATVILQII*RNTRL*DPIEDDISLD 5
GTT DIA + P K TV++ + T L DPI+D+ S+D
Sbjct: 19 GTTGLDIAKGISPSLAKRTVVMALNGTLTDLADPIDDNASID 60


>sp|Q54Z20|CUPJ_DICDI Putative calcium up-regulated protein J
OS=Dictyostelium discoideum GN=cupJ PE=3 SV=1
Length = 655

Score = 32.3 bits (72), Expect = 0.76
Identities = 13/28 (46%), Positives = 16/28 (57%)
Frame = +2

Query: 14 NVIFDWILQPSIPLYDLENHCSFPFPRY 97
NV F W L+PS PL + + PFP Y
Sbjct: 173 NVCFQWDLEPSFPLNSILTQTTEPFPNY 200


>sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus
norvegicus GN=Acsl6 PE=1 SV=1
Length = 697

Score = 30.8 bits (68), Expect = 2.2
Identities = 17/62 (27%), Positives = 30/62 (48%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S + DI T++V + KA ++L+ +
Sbjct: 158 PEWIIAELACYTYSMVVVPLYDTLGPG----SIRYIINTADICTVIVDKPHKAILLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>sp|Q5AL27|AKR1_CANAL Palmitoyltransferase AKR1 OS=Candida albicans
GN=AKR1 PE=3 SV=1
Length = 813

Score = 30.4 bits (67), Expect = 2.9
Identities = 20/69 (28%), Positives = 30/69 (43%)
Frame = -2

Query: 373 TQAQVEQEPVAGSNEGECFADVASMDSIENVENLADSNGPVQIEQGPEWVSAEVECAASG 194
T A E PV SNE D + ++N ++ DSN E E + +E+ A
Sbjct: 66 TTATTESSPVTTSNE----TDPIELSVLDNADHAIDSNSIKSTEAVLETLDSELNTIADT 121

Query: 193 ASMIPMQQE 167
+ P +QE
Sbjct: 122 KTEPPTEQE 130


>sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo
sapiens GN=ACSL6 PE=2 SV=4
Length = 697

Score = 29.3 bits (64), Expect = 6.5
Identities = 15/62 (24%), Positives = 31/62 (50%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ E+ C ++P+ G + + DI+T++V + +KA ++L+ +
Sbjct: 158 PEWIIVELACYTYSMVVVPLYDTLGPG----AIRYIINTADISTVIVDKPQKAVLLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>sp|Q9P217|ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5
OS=Homo sapiens GN=ZSWIM5 PE=2 SV=2
Length = 1185

Score = 28.9 bits (63), Expect = 8.4
Identities = 17/48 (35%), Positives = 23/48 (47%)
Frame = +2

Query: 32 ILQPSIPLYDLENHCSFPFPRYHHCRDVPTCCSI*GRVSSCISSCFLL 175
+L PS P+ + CS+P P+ HH R P G SSC +L
Sbjct: 10 LLSPS-PVSPAKRQCSWPSPQAHHPRGSPGAAG--GGAGGVGSSCLVL 54


>sp|Q7VUZ9|Y2916_BORPE UPF0234 protein BP2916 OS=Bordetella
pertussis GN=BP2916 PE=3 SV=1
Length = 160

Score = 28.9 bits (63), Expect = 8.4
Identities = 17/49 (34%), Positives = 26/49 (53%)
Frame = -2

Query: 313 DVASMDSIENVENLADSNGPVQIEQGPEWVSAEVECAASGASMIPMQQE 167
DV MD + +ENL + V I+QG E A+ AA AS + ++ +
Sbjct: 73 DVRCMDVADPLENLGGARQKVTIKQGIEQAIAKKLIAAIKASKVKVESQ 121


>sp|Q7WMU0|Y1300_BORBR UPF0234 protein BB1300 OS=Bordetella
bronchiseptica GN=BB1300 PE=3 SV=1
Length = 160

Score = 28.9 bits (63), Expect = 8.4
Identities = 17/49 (34%), Positives = 26/49 (53%)
Frame = -2

Query: 313 DVASMDSIENVENLADSNGPVQIEQGPEWVSAEVECAASGASMIPMQQE 167
DV MD + +ENL + V I+QG E A+ AA AS + ++ +
Sbjct: 73 DVRCMDVADPLENLGGARQKVTIKQGIEQAIAKKLIAAIKASKVKVESQ 121


>sp|P44140|Y1254_HAEIN Uncharacterized protein HI1254 OS=Haemophilus
influenzae GN=HI1254 PE=4 SV=1
Length = 353

Score = 28.9 bits (63), Expect = 8.4
Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 9/61 (14%)
Frame = +1

Query: 115 PNLLFHLRQSLILY*FLL---------PVA*ES*KHHLQHTQPQRTPILALVQSEQGHYY 267
PN ++H +Q + Y F + P S +HH T Q+ I ++Q+EQ Y+
Sbjct: 102 PNFIYHFKQCIERYHFPILREESAVEFPTVFYSNEHHKNATLAQQQIIENILQAEQDIYF 161

Query: 268 L 270
L
Sbjct: 162 L 162


tr_hit_id B5E1L0
Definition tr|B5E1L0|B5E1L0_DROPS GA24314 OS=Drosophila pseudoobscura pseudoobscura
Align length 89
Score (bit) 35.8
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913423|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_A12.
(386 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5E1L0|B5E1L0_DROPS GA24314 OS=Drosophila pseudoobscura pseud... 36 1.1
tr|B4GI08|B4GI08_DROPE GL16840 OS=Drosophila persimilis GN=GL168... 36 1.1
tr|Q8R1X1|Q8R1X1_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q8C028|Q8C028_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q8BYJ0|Q8BYJ0_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q5ICG6|Q5ICG6_MOUSE Long chain acyl-CoA synthetase 6 isoform ... 35 1.9
tr|Q5ICG5|Q5ICG5_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q5ICG4|Q5ICG4_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q5F2D0|Q5F2D0_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q5F2C8|Q5F2C8_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|Q5F2C5|Q5F2C5_MOUSE Acyl-CoA synthetase long-chain family mem... 35 1.9
tr|A8IP90|A8IP90_MOUSE Long-chain acyl-CoA synthetase OS=Mus mus... 35 1.9
tr|B4J2H5|B4J2H5_DROGR GH16620 OS=Drosophila grimshawi GN=GH1662... 35 2.5
tr|B3QE39|B3QE39_RHOPT Threonyl-tRNA synthetase OS=Rhodopseudomo... 33 5.5
tr|A1JS86|A1JS86_YERE8 Putative uncharacterized protein OS=Yersi... 33 5.5
tr|B8CRU6|B8CRU6_9GAMM NnrS OS=Shewanella piezotolerans WP3 GN=s... 33 5.5
tr|B5FW59|B5FW59_OTOGA Acyl-CoA synthetase long-chain family mem... 33 5.5
tr|A4QQ95|A4QQ95_MAGGR DNA-directed RNA polymerase OS=Magnaporth... 33 5.5
tr|Q3AIK7|Q3AIK7_SYNSC Putative uncharacterized protein OS=Synec... 33 7.2
tr|Q1NAQ8|Q1NAQ8_9SPHN Putative uncharacterized protein OS=Sphin... 33 7.2
tr|B3RU11|B3RU11_TRIAD Putative uncharacterized protein OS=Trich... 33 7.2
tr|B6KPE2|B6KPE2_TOXGO Putative uncharacterized protein OS=Toxop... 33 9.3

>tr|B5E1L0|B5E1L0_DROPS GA24314 OS=Drosophila pseudoobscura
pseudoobscura GN=GA24314 PE=4 SV=1
Length = 3240

Score = 35.8 bits (81), Expect = 1.1
Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 3/89 (3%)
Frame = +3

Query: 96 TTIVAMSQLVVPSEAESHLVLVPASCCIGIIEAPLAAHSTSADTHSGPCSI*TGPLLSAK 275
+T+ A +Q +P + S + PA+ G A+HSTS + S P T P S
Sbjct: 283 STVKANTQSQLPEKIGSSTTVTPAAA--GAAATATASHSTSNSSSSSPAPAATTPAASTS 340

Query: 276 FSTFSMLSIEATSAKHSPSFD---PATGS 353
+T L +EA+ H P + PA G+
Sbjct: 341 TTTSGSL-VEASGNVHPPEAEIKIPAVGA 368


>tr|B4GI08|B4GI08_DROPE GL16840 OS=Drosophila persimilis GN=GL16840
PE=4 SV=1
Length = 1076

Score = 35.8 bits (81), Expect = 1.1
Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 3/89 (3%)
Frame = +3

Query: 96 TTIVAMSQLVVPSEAESHLVLVPASCCIGIIEAPLAAHSTSADTHSGPCSI*TGPLLSAK 275
+T+ A +Q +P + S + PA+ G A+HSTS + S P T P S
Sbjct: 316 STVKANTQSQLPEKIGSSTTVTPAAA--GAAATATASHSTSNSSSSSPAPAATTPAASTS 373

Query: 276 FSTFSMLSIEATSAKHSPSFD---PATGS 353
+T L +EA+ H P + PA G+
Sbjct: 374 TTTSGSL-VEASGNVHPPEAEIKIPAVGA 401


>tr|Q8R1X1|Q8R1X1_MOUSE Acyl-CoA synthetase long-chain family member
6 OS=Mus musculus GN=Acsl6 PE=2 SV=2
Length = 722

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 183 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 238

Query: 55 *R 50
R
Sbjct: 239 ER 240


>tr|Q8C028|Q8C028_MOUSE Acyl-CoA synthetase long-chain family member
6 OS=Mus musculus GN=Acsl6 PE=2 SV=1
Length = 359

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 158 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>tr|Q8BYJ0|Q8BYJ0_MOUSE Acyl-CoA synthetase long-chain family member
6 OS=Mus musculus GN=Acsl6 PE=2 SV=1
Length = 424

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 158 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>tr|Q5ICG6|Q5ICG6_MOUSE Long chain acyl-CoA synthetase 6 isoform 2
OS=Mus musculus GN=Acsl6 PE=2 SV=1
Length = 722

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 183 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 238

Query: 55 *R 50
R
Sbjct: 239 ER 240


>tr|Q5ICG5|Q5ICG5_MOUSE Acyl-CoA synthetase long-chain family member
6 OS=Mus musculus GN=Acsl6 PE=2 SV=1
Length = 697

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 158 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>tr|Q5ICG4|Q5ICG4_MOUSE Acyl-CoA synthetase long-chain family member
6 OS=Mus musculus GN=Acsl6 PE=2 SV=1
Length = 697

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 158 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 213

Query: 55 *R 50
R
Sbjct: 214 ER 215


>tr|Q5F2D0|Q5F2D0_MOUSE Acyl-CoA synthetase long-chain family member
6 OS=Mus musculus GN=Acsl6 PE=2 SV=1
Length = 722

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 183 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 238

Query: 55 *R 50
R
Sbjct: 239 ER 240


>tr|Q5F2C8|Q5F2C8_MOUSE Acyl-CoA synthetase long-chain family member
6 (Fragment) OS=Mus musculus GN=Acsl6 PE=4 SV=1
Length = 373

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = -2

Query: 235 PEWVSAEVECAASGASMIPMQQEAGTNTR*DSASDGTTSWDIATMVVPRKRKATVILQII 56
PEW+ AE+ C ++P+ G S S + DI T++V + KAT++L+ +
Sbjct: 131 PEWIIAELACYTYSMVVVPLYDTLGPG----SISYIINTADICTVIVDKPHKATLLLEHV 186

Query: 55 *R 50
R
Sbjct: 187 ER 188