BP913453
Clone id YMU001_000030_D08
Library
Length 591
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_D08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GATTTGAACAGGCCACTTTCTGACTTCAGCTCCTCCAACTGTGAATACAGCCTTTTGCCA
TTCTTGGCACTCCAGCTCAAAAAAAGCACCAATACGAGTGATAACTAGGGCACGTGGCTT
TGAACCTGTTCCATTAGCCATCCAGAGCAACTGGCAACCATGCGTGAGAACTTGAACAAA
AAGGTTGTGCAATGTCTTCGAATCCCAGCGTCCGCTAGCTCCAGCGGGAAAAAGATGCAC
ATCCAAGAGCTCCCCCCTAGCATCTGTCCATATGGAAACTAACCACTGCCAGTCCTCTGT
CCAACCATAAGAGCATTGAAAATTTGCTGGCTTTTGGTCTCCCCCACTCGTAACATCATA
ATCCGCACTACTGTCAGCAATTGTACCATGCATGGCCTCCGCTGCACCCACAAGCACATT
TCCTGAAGCATCATCCAATCCAGAAGAGCGGGATGCAGAAACTCCCACACCATGATCTAA
TGTGCCAGCCTCTGCTAAGATAAACAGAGGCTCAAAAAGATACTTGAAACTGTCATAAAG
CTGATGCCCATGATTAACCATACTATTCTCATTCGAGACTCCTTGCTGTTG
■■Homology search results ■■ -
sp_hit_id P45971
Definition sp|P45971|OST48_CAEEL Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Caenorhabditis elegans
Align length 82
Score (bit) 33.1
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913453|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_D08.
(576 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P45971|OST48_CAEEL Probable dolichyl-diphosphooligosaccharide... 33 1.0
sp|Q5UR89|YR643_MIMIV Uncharacterized protein R643 OS=Acanthamoe... 32 2.3
sp|Q7KTX8|MED13_DROME Mediator of RNA polymerase II transcriptio... 32 2.3
sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 32 2.3
sp|Q2EG98|PK1L3_MOUSE Polycystic kidney disease protein 1-like 3... 32 3.0
sp|Q6CLE0|SEC24_KLULA Protein transport protein SEC24 OS=Kluyver... 31 3.9
sp|O80297|COATA_BPIF1 Coat protein A OS=Enterobacteria phage If1... 31 5.1
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thalia... 31 5.1
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus lae... 30 6.6
sp|Q685J3|MUC17_HUMAN Mucin-17 OS=Homo sapiens GN=MUC17 PE=1 SV=1 30 6.6
sp|P20385|CF2_DROME Chorion transcription factor Cf2, isoforms I... 30 6.6
sp|Q01522|CF23_DROME Chorion transcription factor Cf2, isoform I... 30 6.6
sp|Q17RH7|TPRXL_HUMAN Putative protein TPRXL OS=Homo sapiens GN=... 30 8.6
sp|Q3B8N5|PROX2_HUMAN Prospero homeobox protein 2 OS=Homo sapien... 30 8.6
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor ... 30 8.6
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyosteli... 30 8.6
sp|P80203|ACVL1_RAT Serine/threonine-protein kinase receptor R3 ... 30 8.7

>sp|P45971|OST48_CAEEL Probable
dolichyl-diphosphooligosaccharide--protein
glycosyltransferase 48 kDa subunit OS=Caenorhabditis
elegans GN=T09A5.11 PE=2 SV=1
Length = 445

Score = 33.1 bits (74), Expect = 1.0
Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 12/82 (14%)
Frame = -1

Query: 552 NSMVNHGHQLY-----DS----FKY---LFEPLFILAEAGTLDHGVGVSASRSSGLDDAS 409
NS+ GH+L DS FK+ +F+ LFILA G G +S S S DA
Sbjct: 41 NSVKERGHELTVRAADDSQLALFKHGQLIFDHLFILAP-GVQVFGGSLSPSEISKFVDAG 99

Query: 408 GNVLVGAAEAMHGTIADSSADY 343
GNVLV A + + + +A++
Sbjct: 100 GNVLVAAGSNIGDALREIAAEH 121


>sp|Q5UR89|YR643_MIMIV Uncharacterized protein R643 OS=Acanthamoeba
polyphaga mimivirus GN=MIMI_R643 PE=4 SV=1
Length = 361

Score = 32.0 bits (71), Expect = 2.3
Identities = 15/31 (48%), Positives = 16/31 (51%)
Frame = -1

Query: 345 YDVTSGGDQKPANFQCSYGWTEDWQWLVSIW 253
YD T G P N QC Y W E W W+V W
Sbjct: 325 YD-TQVGPAIPLN-QCDYPWAEYWPWVVGSW 353


>sp|Q7KTX8|MED13_DROME Mediator of RNA polymerase II transcription
subunit 13 OS=Drosophila melanogaster GN=skd PE=1 SV=1
Length = 2618

Score = 32.0 bits (71), Expect = 2.3
Identities = 24/86 (27%), Positives = 38/86 (44%)
Frame = -1

Query: 300 CSYGWTEDWQWLVSIWTDARGELLDVHLFPAGASGRWDSKTLHNLFVQVLTHGCQLLWMA 121
C+Y +ED WL++ TD RGE+L+ R + +V + ++ +
Sbjct: 2242 CNYCLSEDQAWLLATATDERGEMLEKICINIDVPNRARRRKAPARYVALKKLMDFIMGII 2301

Query: 120 NGTGSKPRALVITRIGAFFELECQEW 43
+ T R LVI RIG E + W
Sbjct: 2302 SQTSQMWR-LVIGRIGRIGHSELKSW 2326


>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1
Length = 126

Score = 32.0 bits (71), Expect = 2.3
Identities = 15/36 (41%), Positives = 21/36 (58%)
Frame = -1

Query: 126 MANGTGSKPRALVITRIGAFFELECQEWQKAVFTVG 19
MA G+GS RALV+ + F C+ + V+TVG
Sbjct: 1 MAQGSGSAERALVLGVVLVFLVFNCEVAESVVYTVG 36


>sp|Q2EG98|PK1L3_MOUSE Polycystic kidney disease protein 1-like 3
OS=Mus musculus GN=Pkd1l3 PE=2 SV=1
Length = 2201

Score = 31.6 bits (70), Expect = 3.0
Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 7/60 (11%)
Frame = +2

Query: 314 GFWSPPLVTS*SALLSAIVPCMASAAPTSTFPE-------ASSNPEERDAETPTP*SNVP 472
GF SPP VT+ + L+S+ P + S P S+ P ASS+P + ++TP SN P
Sbjct: 404 GFSSPPQVTT-ATLVSSSPPQVTSETPASSSPTQVTSETPASSSPTQVTSDTPA--SNSP 460



Score = 30.0 bits (66), Expect = 8.6
Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 8/96 (8%)
Frame = +2

Query: 188 SQRPLAPAGKRCTSKSSPLASVHMETNHCQSSVQP*EH*KFA-GFWSPPLVTS*SALLSA 364
S+ P + + + TS++ +S T+ +S P + GF SP VT+ + L+S+
Sbjct: 426 SETPASSSPTQVTSETPASSSPTQVTSDTPASNSPPQGTSDTPGFSSPTQVTT-ATLVSS 484

Query: 365 IVPCMASAAPTSTFPE-------ASSNPEERDAETP 451
P + S P S+ P ASS+P + +ETP
Sbjct: 485 SPPQVTSDTPASSSPPQVTSDTPASSSPPQVTSETP 520


>sp|Q6CLE0|SEC24_KLULA Protein transport protein SEC24
OS=Kluyveromyces lactis GN=SEC24 PE=3 SV=1
Length = 924

Score = 31.2 bits (69), Expect = 3.9
Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 7/75 (9%)
Frame = +1

Query: 190 PASASSSGKKMH-------IQELPPSICPYGN*PLPVLCPTIRALKICWLLVSPTRNIII 348
P + GK M+ QELPP I P P++ P P + I+
Sbjct: 138 PGVGMAVGKPMNQLYPVDLFQELPPPITDLSLPPPPLMLP-------------PEKMIVP 184

Query: 349 RTTVSNCTMHGLRCT 393
TV+NC+ H LRCT
Sbjct: 185 NDTVNNCSDH-LRCT 198


>sp|O80297|COATA_BPIF1 Coat protein A OS=Enterobacteria phage If1
GN=III PE=3 SV=1
Length = 460

Score = 30.8 bits (68), Expect = 5.1
Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAG-TLDHGVGVSASRSSGLDDASGNVLVGAAEAMHGTIADSSADY 343
D+ F+ + A+ G +LD V + SG D+ G LVG A+ G A SSA
Sbjct: 318 DALTESFDLSALQADTGASLDGSVQGTLDSLSGFSDSIGG-LVGNGSAISGEFAGSSAAM 376

Query: 342 DVTSGGDQKP 313
+ GD+ P
Sbjct: 377 NAIGEGDKSP 386


>sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana
GN=CYP98A3 PE=1 SV=1
Length = 508

Score = 30.8 bits (68), Expect = 5.1
Identities = 12/34 (35%), Positives = 20/34 (58%)
Frame = -1

Query: 324 DQKPANFQCSYGWTEDWQWLVSIWTDARGELLDV 223
D KP F+C Y W + + ++S+W G +L+V
Sbjct: 42 DIKPVRFRCYYEWAQSYGPIISVWI---GSILNV 72


>sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis
GN=zic2-A PE=2 SV=2
Length = 503

Score = 30.4 bits (67), Expect = 6.6
Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
Frame = +3

Query: 318 FGLPH-S*HHNPHYCQQLYHAWPPLHPQAHFL 410
FG P S HH+PH+ QL HA HPQ H L
Sbjct: 157 FGPPAGSLHHHPHHHHQLSHA---EHPQGHLL 185


>sp|Q685J3|MUC17_HUMAN Mucin-17 OS=Homo sapiens GN=MUC17 PE=1 SV=1
Length = 4493

Score = 30.4 bits (67), Expect = 6.6
Identities = 15/43 (34%), Positives = 24/43 (55%)
Frame = +2

Query: 359 SAIVPCMASAAPTSTFPEASSNPEERDAETPTP*SNVPASAKI 487
S V + A+ +ST PE +S P +E TP +N+P S ++
Sbjct: 539 STPVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTNMPVSTRL 581


tr_hit_id A7P090
Definition tr|A7P090|A7P090_VITVI Chromosome chr6 scaffold_3, whole genome shotgun sequence OS=Vitis vinifera
Align length 189
Score (bit) 176.0
E-value 6.0e-43
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913453|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_D08.
(576 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P090|A7P090_VITVI Chromosome chr6 scaffold_3, whole genome ... 176 6e-43
tr|A5BD64|A5BD64_VITVI Putative uncharacterized protein OS=Vitis... 176 6e-43
tr|Q8GXD0|Q8GXD0_ARATH Putative acetyl-CoA synthetase OS=Arabido... 167 4e-40
tr|Q0DHR5|Q0DHR5_ORYSJ Os05g0447500 protein OS=Oryza sativa subs... 167 5e-40
tr|B8AYR9|B8AYR9_ORYSI Putative uncharacterized protein OS=Oryza... 167 5e-40
tr|Q9C8A3|Q9C8A3_ARATH Acetyl-CoA synthetase, putative; 45051-31... 122 1e-26
tr|A9RVI0|A9RVI0_PHYPA Predicted protein OS=Physcomitrella paten... 117 4e-25
tr|A9TD37|A9TD37_PHYPA Predicted protein OS=Physcomitrella paten... 110 7e-23
tr|Q688J1|Q688J1_ORYSJ Putative uncharacterized protein OSJNBb00... 76 2e-12
tr|Q54Y28|Q54Y28_DICDI Putative uncharacterized protein OS=Dicty... 38 0.45
tr|Q7SEL2|Q7SEL2_NEUCR Putative uncharacterized protein OS=Neuro... 37 0.60
tr|A7ELC7|A7ELC7_SCLS1 Putative uncharacterized protein OS=Scler... 37 0.77
tr|Q47P91|Q47P91_THEFY Putative monooxygenase OS=Thermobifida fu... 37 0.79
tr|A8XJF6|A8XJF6_CAEBR CBR-PQN-37 protein OS=Caenorhabditis brig... 37 0.79
tr|Q7S5D5|Q7S5D5_NEUCR Putative uncharacterized protein OS=Neuro... 37 1.0
tr|A1A5X8|A1A5X8_DANRE Zgc:158367 OS=Danio rerio GN=zgc:158367 P... 35 2.3
tr|A5HBA1|A5HBA1_BRARP Mutant WD-like protein OS=Brassica rapa s... 35 2.3
tr|B6KRT8|B6KRT8_TOXGO Putative uncharacterized protein OS=Toxop... 35 2.3
tr|B3NHN9|B3NHN9_DROER GG15723 OS=Drosophila erecta GN=GG15723 P... 35 2.3
tr|Q9W1T6|Q9W1T6_DROME CG34371 OS=Drosophila melanogaster GN=CG3... 35 3.0
tr|B4QI71|B4QI71_DROSI GD25075 OS=Drosophila simulans GN=GD25075... 35 3.0
tr|B3NP97|B3NP97_DROER GG20058 OS=Drosophila erecta GN=GG20058 P... 35 3.0
tr|Q4QDW5|Q4QDW5_LEIMA Putative uncharacterized protein OS=Leish... 35 3.8
tr|B4JM60|B4JM60_DROGR GH24392 OS=Drosophila grimshawi GN=GH2439... 34 5.0
tr|A8X1H7|A8X1H7_CAEBR Putative uncharacterized protein OS=Caeno... 34 5.0
tr|Q8XPL8|Q8XPL8_RALSO Putative surface-exposed adhesin protein ... 34 5.1
tr|B6M411|B6M411_BRAFL Putative uncharacterized protein OS=Branc... 34 5.1
tr|B6M3Z1|B6M3Z1_BRAFL Putative uncharacterized protein OS=Branc... 34 5.1
tr|Q8IH14|Q8IH14_DROME CG3056, isoform B OS=Drosophila melanogas... 34 6.5
tr|O76876|O76876_DROME CG3056, isoform A OS=Drosophila melanogas... 34 6.5

>tr|A7P090|A7P090_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024815001
PE=4 SV=1
Length = 863

Score = 176 bits (447), Expect = 6e-43
Identities = 95/189 (50%), Positives = 120/189 (63%), Gaps = 16/189 (8%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGL-------DDASGNVLVGAAEAMH---- 373
D +Y+FEPLFILAE G+L+HGV +A + G DD SG + A+ A
Sbjct: 363 DEVRYMFEPLFILAEPGSLEHGVSATAFGNLGSESLKTLSDDGSGGFMQSASSAGSIDTG 422

Query: 372 -GTIADSSADYDVTSGGDQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFP-AGAS 199
G+ D S SG + + C YGWTEDW+WLV IWTD+RGELLD H+FP G S
Sbjct: 423 PGSQLDGSESDGFGSGHQKNLPSLHCCYGWTEDWRWLVCIWTDSRGELLDSHIFPFGGIS 482

Query: 198 GRWDSKTLHNLFVQVLTHGCQLLWMANGTGS---KPRALVITRIGAFFELECQEWQKAVF 28
R D+K L LFVQ+L G Q+L + + KPR LVITRIG+F+ELECQEWQKA++
Sbjct: 483 SRQDTKGLQCLFVQILQQGSQILQACSSPDTGIVKPRDLVITRIGSFYELECQEWQKAIY 542

Query: 27 TVGGAEVRK 1
+VGG+EVRK
Sbjct: 543 SVGGSEVRK 551


>tr|A5BD64|A5BD64_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024990 PE=4 SV=1
Length = 893

Score = 176 bits (447), Expect = 6e-43
Identities = 95/189 (50%), Positives = 120/189 (63%), Gaps = 16/189 (8%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGL-------DDASGNVLVGAAEAMH---- 373
D +Y+FEPLFILAE G+L+HGV +A + G DD SG + A+ A
Sbjct: 424 DEVRYMFEPLFILAEPGSLEHGVSATAFGNLGSESLKTLSDDGSGGFMQSASSAGSIDTG 483

Query: 372 -GTIADSSADYDVTSGGDQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFP-AGAS 199
G+ D S SG + + C YGWTEDW+WLV IWTD+RGELLD H+FP G S
Sbjct: 484 PGSQLDGSESDGFGSGHQKNLPSLHCCYGWTEDWRWLVCIWTDSRGELLDSHIFPFGGIS 543

Query: 198 GRWDSKTLHNLFVQVLTHGCQLLWMANGTGS---KPRALVITRIGAFFELECQEWQKAVF 28
R D+K L LFVQ+L G Q+L + + KPR LVITRIG+F+ELECQEWQKA++
Sbjct: 544 SRQDTKGLQCLFVQILQQGSQILQACSSPDTGIVKPRDLVITRIGSFYELECQEWQKAIY 603

Query: 27 TVGGAEVRK 1
+VGG+EVRK
Sbjct: 604 SVGGSEVRK 612


>tr|Q8GXD0|Q8GXD0_ARATH Putative acetyl-CoA synthetase
OS=Arabidopsis thaliana GN=At1g55320/F7A10_14 PE=2 SV=1
Length = 767

Score = 167 bits (423), Expect = 4e-40
Identities = 90/189 (47%), Positives = 115/189 (60%), Gaps = 9/189 (4%)
Frame = -1

Query: 540 NHGHQLYDSFKYLFEPLFILAEAGTLDHGVG-----VSASRSSGLDDASGNVLVGAAEAM 376
N L D YLFEPLFIL+E G+++ GV + + S + + G +M
Sbjct: 272 NGDFYLNDEIFYLFEPLFILSEPGSVERGVSPTFTSLGSESSKPIPEDGGRGSGPGMNSM 331

Query: 375 HGTIADSSADYDVTSGGDQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFP-AGAS 199
G + SS+ DV+ + + C YGWTEDW+WLVSIWTDARGELLD H+FP G S
Sbjct: 332 EGITSGSSSQGDVSQLEGKAIPSLHCCYGWTEDWRWLVSIWTDARGELLDTHIFPFGGIS 391

Query: 198 GRWDSKTLHNLFVQVLTHGCQLLWMANGTGS---KPRALVITRIGAFFELECQEWQKAVF 28
R D+K L LFVQVL GCQ+L + + KPR VITRIG FFELE QEWQKA++
Sbjct: 392 SRQDTKGLQCLFVQVLQQGCQILQACSSPDNGSFKPRDFVITRIGNFFELEYQEWQKAIY 451

Query: 27 TVGGAEVRK 1
+ GG E++K
Sbjct: 452 SAGGPEIKK 460


>tr|Q0DHR5|Q0DHR5_ORYSJ Os05g0447500 protein OS=Oryza sativa subsp.
japonica GN=Os05g0447500 PE=4 SV=1
Length = 2036

Score = 167 bits (422), Expect = 5e-40
Identities = 87/177 (49%), Positives = 118/177 (66%), Gaps = 4/177 (2%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGLDDASGNVLVGAAEAMHGTIADSSADYD 340
D KY FEPLFILAE G++D+ G+ +S+S DASG+ G ++ G +DS A
Sbjct: 1550 DDRKYAFEPLFILAEPGSVDYSSGMESSKSGV--DASGS---GIYSSISGGGSDSGASAS 1604

Query: 339 VTSGG--DQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFP-AGASGRWDSKTLHN 169
G + A+ C YGWTEDW+WLV IWTD++GELLD +FP G S R D+K L +
Sbjct: 1605 ALLEGSDNDNAASLHCCYGWTEDWRWLVCIWTDSKGELLDSLIFPFGGISSRQDTKVLQS 1664

Query: 168 LFVQVLTHGCQLLWMA-NGTGSKPRALVITRIGAFFELECQEWQKAVFTVGGAEVRK 1
LF+Q+L HGCQ++ A + ++PR ++ITRIG F ELE QEWQKA+++ GG EV+K
Sbjct: 1665 LFIQILQHGCQIMSSAPESSNTRPRDVIITRIGGFLELEIQEWQKAIYSFGGNEVKK 1721


>tr|B8AYR9|B8AYR9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20152 PE=4 SV=1
Length = 2010

Score = 167 bits (422), Expect = 5e-40
Identities = 87/177 (49%), Positives = 118/177 (66%), Gaps = 4/177 (2%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGLDDASGNVLVGAAEAMHGTIADSSADYD 340
D KY FEPLFILAE G++D+ G+ +S+S DASG+ G ++ G +DS A
Sbjct: 1524 DDRKYAFEPLFILAEPGSVDYSSGMESSKSGV--DASGS---GIYSSISGGGSDSGASAS 1578

Query: 339 VTSGG--DQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFP-AGASGRWDSKTLHN 169
G + A+ C YGWTEDW+WLV IWTD++GELLD +FP G S R D+K L +
Sbjct: 1579 ALLEGSDNDNAASLHCCYGWTEDWRWLVCIWTDSKGELLDSLIFPFGGISSRQDTKVLQS 1638

Query: 168 LFVQVLTHGCQLLWMA-NGTGSKPRALVITRIGAFFELECQEWQKAVFTVGGAEVRK 1
LF+Q+L HGCQ++ A + ++PR ++ITRIG F ELE QEWQKA+++ GG EV+K
Sbjct: 1639 LFIQILQHGCQIMSSAPESSNTRPRDVIITRIGGFLELEIQEWQKAIYSFGGNEVKK 1695


>tr|Q9C8A3|Q9C8A3_ARATH Acetyl-CoA synthetase, putative; 45051-31547
OS=Arabidopsis thaliana GN=F7A10.14 PE=1 SV=1
Length = 2655

Score = 122 bits (306), Expect = 1e-26
Identities = 72/188 (38%), Positives = 95/188 (50%), Gaps = 8/188 (4%)
Frame = -1

Query: 540 NHGHQLYDSFKYLFEPLFILAEAGTLDHGVG-----VSASRSSGLDDASGNVLVGAAEAM 376
N L D YLFEPLFIL+E G+++ GV + + S + + G +M
Sbjct: 2177 NGDFYLNDEIFYLFEPLFILSEPGSVERGVSPTFTSLGSESSKPIPEDGGRGSGPGMNSM 2236

Query: 375 HGTIADSSADYDVTSGGDQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFPAGASG 196
G + SS+ DV+ + + C YGWTEDW+WLVSIWTDAR
Sbjct: 2237 EGITSGSSSQGDVSQLEGKAIPSLHCCYGWTEDWRWLVSIWTDAR--------------- 2281

Query: 195 RWDSKTLHNLFVQVLTHGCQLLWMANGTGS---KPRALVITRIGAFFELECQEWQKAVFT 25
VL GCQ+L + + KPR VITRIG FFELE QEWQKA+++
Sbjct: 2282 -------------VLQQGCQILQACSSPDNGSFKPRDFVITRIGNFFELEYQEWQKAIYS 2328

Query: 24 VGGAEVRK 1
GG E++K
Sbjct: 2329 AGGPEIKK 2336


>tr|A9RVI0|A9RVI0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161291 PE=4 SV=1
Length = 2216

Score = 117 bits (294), Expect = 4e-25
Identities = 72/183 (39%), Positives = 96/183 (52%), Gaps = 10/183 (5%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGLDDASGNVLVGA----AEAMHGTIADSS 352
+ +Y++EP +ILA +G + +R+ D V V + A A G DS+
Sbjct: 1601 EKIRYMYEPAYILARSGAQ------APARTLSCDATRDAVAVSSHRTSAAASSGPDVDST 1654

Query: 351 A-----DYDVTSGGDQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFPAGASGRWD 187
A D D +S Q+ A+ C Y W+EDW WLVS+WTDARGELLD L P
Sbjct: 1655 ATTERLDGDASSAA-QQAADLYCCYTWSEDWNWLVSVWTDARGELLDTLLLPLTGIDTTR 1713

Query: 186 SKTLHNLFVQVLTHGCQLLWMANGTGS-KPRALVITRIGAFFELECQEWQKAVFTVGGAE 10
L LF Q+L G QLL +A GS + R L ITR+G F+ ECQEW + + G E
Sbjct: 1714 ENCLRLLFDQILQQGLQLLNLAVEAGSCRSRGLNITRLGGFYVRECQEWHRVIILAGADE 1773

Query: 9 VRK 1
+RK
Sbjct: 1774 MRK 1776


>tr|A9TD37|A9TD37_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_193900 PE=4 SV=1
Length = 793

Score = 110 bits (274), Expect = 7e-23
Identities = 68/184 (36%), Positives = 91/184 (49%), Gaps = 11/184 (5%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGLDDASGNVLVGAAEAMHGTIADSSADYD 340
++ +YL+EP +ILA +G AS + DA + + G G A S +D D
Sbjct: 298 ENVRYLYEPAYILARSGA-------QASAVAFCSDAIRDAVAGCNPRATGN-ASSGSDVD 349

Query: 339 VTS----------GGDQKPANFQCSYGWTEDWQWLVSIWTDARGELLDVHLFPAGASGRW 190
T+ G ++ A+ C Y W+ DW WLVS+WTDARGELLD L
Sbjct: 350 STAITERMDADANGVAEQAADLYCCYTWSVDWNWLVSVWTDARGELLDTQLLSLTGIDTT 409

Query: 189 DSKTLHNLFVQVLTHGCQLLWMANGTGS-KPRALVITRIGAFFELECQEWQKAVFTVGGA 13
L LF Q+L G QLL +A GS + R L ITR+G F+ E EW + + G
Sbjct: 410 RENCLQILFHQILQQGLQLLNLAVEAGSCRSRGLNITRLGGFYAKESHEWHRVIMAAGAD 469

Query: 12 EVRK 1
EVRK
Sbjct: 470 EVRK 473


>tr|Q688J1|Q688J1_ORYSJ Putative uncharacterized protein
OSJNBb0012G21.6 OS=Oryza sativa subsp. japonica
GN=OSJNBb0012G21.6 PE=4 SV=1
Length = 1020

Score = 75.9 bits (185), Expect = 2e-12
Identities = 51/151 (33%), Positives = 71/151 (47%), Gaps = 11/151 (7%)
Frame = -1

Query: 519 DSFKYLFEPLFILAEAGTLDHGVGVSASRSSGLDDASGNVLVGAAEAMHGTIADSSADYD 340
D KY FEPLFILAE G++D+ G+ +S+S DASG+ G ++ G +DS A
Sbjct: 829 DDRKYAFEPLFILAEPGSVDYSSGMESSKSG--VDASGS---GIYSSISGGGSDSGASAS 883

Query: 339 VTSGG--DQKPANFQCSYGWTEDWQWLVSIWTD---------ARGELLDVHLFPAGASGR 193
G + A+ C YGWTEDW+ ++ + +RG F A+GR
Sbjct: 884 ALLEGSDNDNAASLHCCYGWTEDWRCIIDHYGGSIAAVQEKMSRGSGKQTRNFTQEAAGR 943

Query: 192 WDSKTLHNLFVQVLTHGCQLLWMANGTGSKP 100
+HN+ V L WM SKP
Sbjct: 944 DHETEMHNVLEAVAAELHSLSWMTEEIASKP 974


>tr|Q54Y28|Q54Y28_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0205464 PE=4 SV=1
Length = 823

Score = 37.7 bits (86), Expect = 0.45
Identities = 36/162 (22%), Positives = 67/162 (41%)
Frame = +2

Query: 8 TSAPPTVNTAFCHSWHSSSKKAPIRVITRARGFEPVPLAIQSNWQPCVRT*TKRLCNVFE 187
T+AP + TA + K P T A +P PL S+ +T +K
Sbjct: 164 TTAPVSKPTA-------TVAKKPAAATTTAATSKPAPLTTSSSSSNLKKTDSKTKLTSTT 216

Query: 188 SQRPLAPAGKRCTSKSSPLASVHMETNHCQSSVQP*EH*KFAGFWSPPLVTS*SALLSAI 367
+ +P+ K TS AS+ T ++ + + P+ T+ + +
Sbjct: 217 TSTTSSPSPKPTTSAVKKPASLTTTTTTTTATTK-------TSTPTKPITTTPTKPTTTP 269

Query: 368 VPCMASAAPTSTFPEASSNPEERDAETPTP*SNVPASAKINR 493
V +++ + T++ P +S P + TPT SN P+S+ + +
Sbjct: 270 VSKVSTPSKTTSTPTKTSTPTKTSTTTPTKLSNTPSSSSLKK 311