BP913454
Clone id YMU001_000030_D09
Library
Length 580
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAGAGGAATGCATGCGTCAGCTTTACCCTATACAATACAATGCCATGAGACAAAAACTC
CCTTAANTNNCCATACGAGTACACGCGGGGNNCNTAATGGTCCTTGNTCNTCTAGGGGCA
GCCTCATAAAAGTGCCCACAACGTAAAAAAGGAAGAAATATGAACACTCACAACCCATAA
AAAGGGAGTTCATGCACCAGTTGTGGCCAGCCTTACAACCAAAGACCCTCACATTACACT
TATGGTTATGAATTGCTACCTATCGTGCAGATATCACCTTCATTCTGTCACATCATATAC
CTTGAGCTTAAGATTCACTTCAGCATCTAAAGAACCACACCTTTGACTATCACATTGCAG
CAACCTGCAGTGCATGTTTTGGTACTATAACTTTTCCACCCAGTAACACTTCTAAACCGC
AGTGGTTTGCATCAACAGCAGCAAAGTGTTGCTGCATTTCCGTGCTGCACCTTCCTAGTA
TCTGCTTGATGCAAACTTTAACCCTATTAATTTCGCACCTATGTAGACACTCATTGCCTG
CAGTCTATTAACTAAAAAGAACTTCGGAGAGACACTCTTA
■■Homology search results ■■ -
sp_hit_id Q9LUK1
Definition sp|Q9LUK1|FB275_ARATH Putative F-box protein At5g40050 OS=Arabidopsis thaliana
Align length 74
Score (bit) 33.9
E-value 0.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913454|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_D09.
(580 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LUK1|FB275_ARATH Putative F-box protein At5g40050 OS=Arabid... 34 0.60
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2... 30 6.7
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos tauru... 30 6.7
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 O... 30 8.7

>sp|Q9LUK1|FB275_ARATH Putative F-box protein At5g40050
OS=Arabidopsis thaliana GN=At5g40050 PE=4 SV=1
Length = 302

Score = 33.9 bits (76), Expect = 0.60
Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
Frame = +2

Query: 122 PHKSAHNVKKEEI*TLTTHKKGVHAPVVASLTTKDPHITLMVMNCYLSCRY----HLHSV 289
PH AHN+KK + + V AP + S+ T P++ + + YL+C Y H + +
Sbjct: 142 PHYIAHNIKKLTV----CYNNDVQAPRILSIYT--PNLVYLDYSDYLTCLYNSENHFNDL 195

Query: 290 TSYTLSLRFTSASK 331
L L F A +
Sbjct: 196 LEARLDLAFARAGR 209


>sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2
PE=2 SV=1
Length = 2270

Score = 30.4 bits (67), Expect = 6.7
Identities = 16/54 (29%), Positives = 28/54 (51%)
Frame = +3

Query: 402 SNTSKPQWFASTAAKCCCISVLHLPSICLMQTLTLLISHLCRHSLPAVY*LKRT 563
S+ S P WF + CCC+ ++ ++ + TL +I+H SL +KR+
Sbjct: 773 SDVSFPLWFKTLMMVCCCVKDCYIQNVAI-STLLEVINHSQSLSLVLADRMKRS 825


>sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus
GN=SMPD1 PE=2 SV=1
Length = 625

Score = 30.4 bits (67), Expect = 6.7
Identities = 13/41 (31%), Positives = 18/41 (43%)
Frame = +3

Query: 363 TCSACFGTITFPPSNTSKPQWFASTAAKCCCISVLHLPSIC 485
TC F I F N + W S A K C + + P++C
Sbjct: 87 TCKGLFTAIDFGLRNQASVAWVGSVAIKLCVLLKIAPPAVC 127


>sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3
OS=Saccharomyces cerevisiae GN=GPI13 PE=1 SV=1
Length = 1017

Score = 30.0 bits (66), Expect = 8.7
Identities = 24/93 (25%), Positives = 40/93 (43%)
Frame = +3

Query: 252 IATYRADITFILSHHIP*A*DSLQHLKNHTFDYHIAATCSACFGTITFPPSNTSKPQWFA 431
I + + DI F+LS + + + N TF HI + S T+ P + KPQ
Sbjct: 881 IPSVQWDIGFMLSEKVTFPFTQIAIILN-TFGPHILVSLSVALLTLWSQPPDVLKPQTLL 939

Query: 432 STAAKCCCISVLHLPSICLMQTLTLLISHLCRH 530
C I + + +CL + + ++H RH
Sbjct: 940 GRIVSNCGILLTYNTILCL--SSFIWVTHFRRH 970


tr_hit_id B4KE04
Definition tr|B4KE04|B4KE04_DROMO GI10295 OS=Drosophila mojavensis
Align length 56
Score (bit) 33.5
E-value 8.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913454|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_D09.
(580 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4KE04|B4KE04_DROMO GI10295 OS=Drosophila mojavensis GN=GI102... 33 8.8

>tr|B4KE04|B4KE04_DROMO GI10295 OS=Drosophila mojavensis GN=GI10295
PE=4 SV=1
Length = 817

Score = 33.5 bits (75), Expect = 8.8
Identities = 20/56 (35%), Positives = 25/56 (44%)
Frame = -1

Query: 220 GCKAGHNWCMNSLFMGCECSYFFLFYVVGTFMRLPLXXQGPLXXPRVLVWXXKGVF 53
G KAG +N +F FFL + R+P G L P L+W KGVF
Sbjct: 415 GTKAGSQSVLNLIFEALVRLVFFLLIIFVLLQRVPWLVSGILLLP-TLLWSYKGVF 469