BP913478
Clone id YMU001_000030_F10
Library
Length 458
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_F10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGGCGTGCAGGGCATCTCGACAAGGCGGTAAAAGTGATTCAGAGGATGCCTACGTTTGA
TAATTCTATCGCACTTTGGTCTGCCCTCTTGGGCGCCTGTCATAAGTGGGGAGATGTGAA
TGTTGGGAGATGGGCCTTTGAGCAAGCACTTCAAGTGGATAGGAAGCGATGGAGCAGCGT
ATGTACTTATGTCCAATATTTATGCTGCTGCGGGCATGCAAGAAGATGCTGAAAAAATCA
AATCTATGAGATTCATGAACAAGGCCATGTAGCGGGATCGTGTTGGAAGTTTCGATACCA
ATTCATAGTGCCACATTATGGTGTATAAACATGTATAAGATTGTTTCCCAAGTTTGTCGA
TCATCGTGAGCTGTTGTTGTCAAATTTCATGAGAAAACTGTGCTTATGTAGGGGGCACAT
GTTGTACCTTGATGTAGGGCAGACATTTAAGTGTGCTT
■■Homology search results ■■ -
sp_hit_id Q9C9I6
Definition sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protein At1g71490 OS=Arabidopsis thaliana
Align length 52
Score (bit) 49.7
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913478|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_F10.
(458 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protei... 50 3e-07
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 44 4e-07
sp|Q9LUL5|PP229_ARATH Pentatricopeptide repeat-containing protei... 44 5e-07
sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protei... 46 6e-07
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protei... 43 7e-07
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 43 8e-07
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 42 2e-06
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 42 2e-06
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protei... 45 4e-06
sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protei... 42 5e-06
sp|Q9SCT2|PP277_ARATH Pentatricopeptide repeat-containing protei... 43 5e-06
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 50 6e-06
sp|Q9LR72|PPR7_ARATH Putative pentatricopeptide repeat-containin... 41 7e-06
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 38 8e-06
sp|O80488|PPR23_ARATH Pentatricopeptide repeat-containing protei... 37 9e-06
sp|Q9M2Y4|PP276_ARATH Pentatricopeptide repeat-containing protei... 37 1e-05
sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containi... 42 2e-05
sp|Q9CA73|PP119_ARATH Putative pentatricopeptide repeat-containi... 40 3e-05
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 37 4e-05
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 42 5e-05
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 42 7e-05
sp|Q9SVH0|PP329_ARATH Pentatricopeptide repeat-containing protei... 41 7e-05
sp|Q9ZVF4|PP140_ARATH Pentatricopeptide repeat-containing protei... 35 7e-05
sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containi... 40 9e-05
sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protei... 35 1e-04
sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protei... 36 1e-04
sp|Q0WSH6|PP312_ARATH Pentatricopeptide repeat-containing protei... 39 1e-04
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 40 1e-04
sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protei... 39 1e-04
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 35 1e-04

>sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protein
At1g71490 OS=Arabidopsis thaliana GN=PCMP-E67 PE=2 SV=1
Length = 681

Score = 49.7 bits (117), Expect(2) = 3e-07
Identities = 24/52 (46%), Positives = 33/52 (63%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQV 157
GRAG L KA +I MP + S A W+ LL ACH G+ +G+WA E+ L++
Sbjct: 530 GRAGFLAKAKDIIHNMP-YKPSGATWATLLNACHIHGNTQIGKWAAEKLLEM 580



Score = 24.3 bits (51), Expect(2) = 3e-07
Identities = 9/23 (39%), Positives = 17/23 (73%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
YVL++N+YAAAG +++++
Sbjct: 588 YVLIANMYAAAGSWSKLAEVRTI 610


>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein
At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1
Length = 834

Score = 44.3 bits (103), Expect(2) = 4e-07
Identities = 24/55 (43%), Positives = 35/55 (63%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVDRK 166
GRAG L+KA ++I++MPT +I +W +LL C K G+V + A E A+ D K
Sbjct: 702 GRAGRLNKARELIEKMPTKPAAI-VWRSLLSGCAKAGNVELAEHAAEMAILSDPK 755



Score = 29.3 bits (64), Expect(2) = 4e-07
Identities = 10/25 (40%), Positives = 19/25 (76%)
Frame = +3

Query: 168 DGAAYVLMSNIYAAAGMQEDAEKIK 242
D ++ ++SNIYA+ GM +A+K++
Sbjct: 756 DSGSFTMLSNIYASKGMWTEAKKVR 780


>sp|Q9LUL5|PP229_ARATH Pentatricopeptide repeat-containing protein
At3g14330 OS=Arabidopsis thaliana GN=PCMP-H57 PE=2 SV=2
Length = 710

Score = 44.3 bits (103), Expect(2) = 5e-07
Identities = 22/48 (45%), Positives = 33/48 (68%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQ 145
GRAG + +AVKVI+ MP F S ++W +LL +C G+V+VG A ++
Sbjct: 485 GRAGKIKEAVKVIETMP-FKPSASIWGSLLNSCRLHGNVSVGEIAAKE 531



Score = 28.9 bits (63), Expect(2) = 5e-07
Identities = 12/23 (52%), Positives = 18/23 (78%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
YV++SNIYA A M ++ +KI+ M
Sbjct: 543 YVMVSNIYADAKMWDNVDKIREM 565


>sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protein
At3g29230 OS=Arabidopsis thaliana GN=PCMP-E27 PE=2 SV=1
Length = 600

Score = 46.2 bits (108), Expect(2) = 6e-07
Identities = 20/53 (37%), Positives = 33/53 (62%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR G L +A+KV+Q MP N + +W ALLGAC +V++ + + +++D
Sbjct: 463 GRVGRLKEAIKVVQTMPMEPN-VVIWGALLGACRMHNEVDIAKEVLDNLVKLD 514



Score = 26.6 bits (57), Expect(2) = 6e-07
Identities = 16/34 (47%), Positives = 20/34 (58%)
Frame = +3

Query: 168 DGAAYVLMSNIYAAAGMQEDAEKIKSMRFMNKAM 269
D Y L+SNIYAAA ED E + +R K+M
Sbjct: 517 DPGNYSLLSNIYAAA---EDWEGVADIRSKMKSM 547


>sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protein
At5g15300 OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=2
Length = 548

Score = 43.1 bits (100), Expect(2) = 7e-07
Identities = 21/52 (40%), Positives = 34/52 (65%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQV 157
GRAG L++A ++ M N+I +W LLGAC +G+V +G++A E+ L +
Sbjct: 427 GRAGQLEEAFMFVESMKIEPNAI-VWRTLLGACKIYGNVELGKYANEKLLSM 477



Score = 29.6 bits (65), Expect(2) = 7e-07
Identities = 11/23 (47%), Positives = 17/23 (73%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
YVL+SNIYA+ G + +K++ M
Sbjct: 485 YVLLSNIYASTGQWDGVQKVRKM 507



Score = 30.8 bits (68), Expect = 2.9
Identities = 17/74 (22%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
Frame = +2

Query: 5 RAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVDRKRWSSVC 184
+ G +D+A+++ MP D W+ ++ C K +++ R F++ + D W+++
Sbjct: 190 KRGKIDEAMRLFDEMPYKDQ--VAWNVMITGCLKCKEMDSARELFDRFTEKDVVTWNAMI 247

Query: 185 T-YVQYLCCCGHAR 223
+ YV CG+ +
Sbjct: 248 SGYVN----CGYPK 257



Score = 29.3 bits (64), Expect = 8.6
Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
Frame = +2

Query: 5 RAGHLDKAVKVIQRMPTFDNSIALWSAL---LGACHKWGDVNVGRWAFEQALQVDRKRWS 175
+ G +D+A++V + + D ++ W+ L L H G + + FE+ ++ K W
Sbjct: 327 KCGSIDRAIEVFRGVK--DRDLSTWNTLIVGLALHHAEGSIEM----FEEMQRL--KVWP 378

Query: 176 SVCTYVQYLCCCGHARRC*KNQIY 247
+ T++ + C H+ R + + Y
Sbjct: 379 NEVTFIGVILACSHSGRVDEGRKY 402


>sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protein
At1g77170 OS=Arabidopsis thaliana GN=PCMP-E21 PE=2 SV=1
Length = 467

Score = 43.1 bits (100), Expect(2) = 8e-07
Identities = 18/52 (34%), Positives = 30/52 (57%)
Frame = +2

Query: 5 RAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
R G L +A KV++ MP N + +W L+G C K+GDV + W ++++
Sbjct: 369 RDGQLKEAKKVVEEMPMKPN-VMVWGCLMGGCEKFGDVEMAEWVAPYMVELE 419



Score = 29.3 bits (64), Expect(2) = 8e-07
Identities = 11/28 (39%), Positives = 21/28 (75%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKIKSM 248
+DG YV+++N+YA GM +D E+++ +
Sbjct: 422 NDGV-YVVLANVYALRGMWKDVERVRKL 448


>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein
At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1
Length = 842

Score = 41.6 bits (96), Expect(2) = 2e-06
Identities = 20/48 (41%), Positives = 33/48 (68%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQ 145
GRAG L++AV++I+ MP N + +W++LL AC G+V + +A E+
Sbjct: 618 GRAGLLEEAVQLIEDMPMEPNDV-IWNSLLAACRVQGNVEMAAYAAEK 664



Score = 29.3 bits (64), Expect(2) = 2e-06
Identities = 11/22 (50%), Positives = 17/22 (77%)
Frame = +3

Query: 177 AYVLMSNIYAAAGMQEDAEKIK 242
+YVL+SN+YA+AG D K++
Sbjct: 675 SYVLLSNVYASAGRWNDMAKVR 696


>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein
At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1
Length = 697

Score = 42.0 bits (97), Expect(2) = 2e-06
Identities = 19/53 (35%), Positives = 35/53 (66%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GRAG L++A +I+ MP +S+ +W +LL AC ++ +G++ E+ L+V+
Sbjct: 540 GRAGFLEEAKSMIEEMPMQPDSV-IWGSLLAACKVHRNITLGKYVAEKLLEVE 591



Score = 28.9 bits (63), Expect(2) = 2e-06
Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKI-KSMR 251
S+ YVL+SN+YA G ED + KSMR
Sbjct: 593 SNSGPYVLLSNMYAELGKWEDVMNVRKSMR 622


>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein
At2g29760, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H33 PE=2 SV=1
Length = 738

Score = 44.7 bits (104), Expect(2) = 4e-06
Identities = 22/53 (41%), Positives = 35/53 (66%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR+G+L+KAVK I+ MP S ++W ALLGAC ++N+ A + L+++
Sbjct: 513 GRSGYLEKAVKFIEAMP-IPPSTSVWGALLGACKIHANLNLAEMACTRLLELE 564



Score = 25.4 bits (54), Expect(2) = 4e-06
Identities = 12/26 (46%), Positives = 19/26 (73%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKIK 242
+DGA +VL+SNIYA G E+ +++
Sbjct: 567 NDGA-HVLLSNIYAKLGKWENVSELR 591


>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein
At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=2 SV=2
Length = 823

Score = 42.0 bits (97), Expect(2) = 5e-06
Identities = 21/53 (39%), Positives = 33/53 (62%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GRAG L+ A+K I+ M + ++W ALL AC G+V++G+ A E +V+
Sbjct: 599 GRAGQLETALKFIKSM-SLQPDASIWGALLSACRVHGNVDLGKIASEHLFEVE 650



Score = 27.7 bits (60), Expect(2) = 5e-06
Identities = 11/23 (47%), Positives = 19/23 (82%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
+VL+SN+YA+AG E ++I+S+
Sbjct: 657 HVLLSNMYASAGKWEGVDEIRSI 679


tr_hit_id A7NVQ5
Definition tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera
Align length 53
Score (bit) 47.8
E-value 1.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913478|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_F10.
(458 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome... 48 1e-08
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 45 2e-08
tr|Q8S7V8|Q8S7V8_ORYSJ cDNA, clone: J090081F08, full insert sequ... 50 2e-08
tr|A7PEI5|A7PEI5_VITVI Chromosome chr11 scaffold_13, whole genom... 54 4e-08
tr|A2XCZ8|A2XCZ8_ORYSI Putative uncharacterized protein OS=Oryza... 50 5e-08
tr|Q69WY1|Q69WY1_ORYSJ Os06g0613100 protein OS=Oryza sativa subs... 47 8e-08
tr|A3BDJ1|A3BDJ1_ORYSJ Putative uncharacterized protein OS=Oryza... 47 8e-08
tr|A5AJY4|A5AJY4_VITVI Putative uncharacterized protein OS=Vitis... 48 1e-07
tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea... 44 1e-07
tr|A3BS46|A3BS46_ORYSJ Putative uncharacterized protein OS=Oryza... 49 2e-07
tr|Q6Z0F9|Q6Z0F9_ORYSJ Os08g0340900 protein OS=Oryza sativa subs... 49 2e-07
tr|A7QIJ2|A7QIJ2_VITVI Chromosome chr9 scaffold_104, whole genom... 45 2e-07
tr|B8B9V6|B8B9V6_ORYSI Putative uncharacterized protein OS=Oryza... 49 2e-07
tr|A9S537|A9S537_PHYPA Predicted protein OS=Physcomitrella paten... 43 3e-07
tr|A7QUQ9|A7QUQ9_VITVI Chromosome chr1 scaffold_180, whole genom... 54 5e-07
tr|A5AMS4|A5AMS4_VITVI Putative uncharacterized protein OS=Vitis... 53 7e-07
tr|A7P9K4|A7P9K4_VITVI Chromosome chr3 scaffold_8, whole genome ... 47 7e-07
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 47 8e-07
tr|A5AX00|A5AX00_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-07
tr|A7QTX0|A7QTX0_VITVI Chromosome undetermined scaffold_171, who... 42 1e-06
tr|A3AZY4|A3AZY4_ORYSJ Putative uncharacterized protein OS=Oryza... 46 1e-06
tr|Q6ASQ9|Q6ASQ9_ORYSJ Os05g0147600 protein OS=Oryza sativa subs... 46 1e-06
tr|A7QEK5|A7QEK5_VITVI Chromosome chr17 scaffold_85, whole genom... 55 1e-06
tr|Q10K51|Q10K51_ORYSJ Pentatricopeptide, putative (Putative unc... 47 2e-06
tr|A7PEJ0|A7PEJ0_VITVI Chromosome chr11 scaffold_13, whole genom... 44 2e-06
tr|A5BGJ8|A5BGJ8_VITVI Putative uncharacterized protein OS=Vitis... 44 2e-06
tr|A7QGY9|A7QGY9_VITVI Chromosome chr3 scaffold_95, whole genome... 45 2e-06
tr|A7PL13|A7PL13_VITVI Chromosome chr7 scaffold_20, whole genome... 43 3e-06
tr|A5AZY0|A5AZY0_VITVI Putative uncharacterized protein OS=Vitis... 43 3e-06
tr|A5BVF2|A5BVF2_VITVI Putative uncharacterized protein OS=Vitis... 45 4e-06

>tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015527001
PE=4 SV=1
Length = 637

Score = 47.8 bits (112), Expect(2) = 1e-08
Identities = 23/53 (43%), Positives = 35/53 (66%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR+G L+ A ++I+ MP + S +W ALLGAC +G+V +G+ EQ L +D
Sbjct: 413 GRSGRLEDAYELIKSMP-MEPSSGVWGALLGACRVYGNVELGKEVAEQLLSLD 464



Score = 34.7 bits (78), Expect(2) = 1e-08
Identities = 13/28 (46%), Positives = 22/28 (78%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKIKSM 248
SD Y+++SNIY+AAG+ DA K++++
Sbjct: 466 SDHRNYIMLSNIYSAAGLWRDASKVRAL 493


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 44.7 bits (104), Expect(2) = 2e-08
Identities = 25/53 (47%), Positives = 31/53 (58%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GRAGHL++A VI MP F ++W ALL AC DV G A E L++D
Sbjct: 499 GRAGHLEEAENVILSMP-FIPGPSVWGALLSACRVHSDVERGERAAENVLKLD 550



Score = 37.0 bits (84), Expect(2) = 2e-08
Identities = 16/27 (59%), Positives = 21/27 (77%)
Frame = +3

Query: 168 DGAAYVLMSNIYAAAGMQEDAEKIKSM 248
D AYV +S+IYAAAG EDAEK++ +
Sbjct: 553 DDGAYVALSSIYAAAGRYEDAEKVRQV 579


>tr|Q8S7V8|Q8S7V8_ORYSJ cDNA, clone: J090081F08, full insert
sequence OS=Oryza sativa subsp. japonica
GN=OSJNBa0091P11.22 PE=2 SV=1
Length = 510

Score = 49.7 bits (117), Expect(2) = 2e-08
Identities = 23/48 (47%), Positives = 34/48 (70%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQ 145
GRAG L++A K+I++MP NS+ +W ALLGAC GD+N+ A ++
Sbjct: 407 GRAGQLEEAYKMIEQMPIPSNSV-VWGALLGACRTHGDINMAERAVQK 453



Score = 32.0 bits (71), Expect(2) = 2e-08
Identities = 17/48 (35%), Positives = 29/48 (60%)
Frame = +3

Query: 168 DGAAYVLMSNIYAAAGMQEDAEKIKSMRFMNKAM*RDRVGSFDTNS*C 311
+G Y+L+S++YAA+G +A +I+ R MN+A R G ++ C
Sbjct: 461 EGGYYILLSDMYAASGRTTEAMEIR--RIMNQAGARKTAGQSSWSTPC 506


>tr|A7PEI5|A7PEI5_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016678001
PE=4 SV=1
Length = 506

Score = 53.9 bits (128), Expect(2) = 4e-08
Identities = 24/53 (45%), Positives = 37/53 (69%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GRAG L++A K+++RMP N I +W L+GAC K+G+V +G W E L+++
Sbjct: 407 GRAGLLEEARKMVERMPMKANVI-VWGCLMGACEKYGNVKMGEWVAEHLLELE 458



Score = 26.6 bits (57), Expect(2) = 4e-08
Identities = 10/28 (35%), Positives = 21/28 (75%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKIKSM 248
+DG +V++SNIYA+ G+ + E+++ +
Sbjct: 461 NDGV-FVVLSNIYASRGLWREVERVRGV 487


>tr|A2XCZ8|A2XCZ8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10183 PE=4 SV=1
Length = 510

Score = 49.7 bits (117), Expect(2) = 5e-08
Identities = 23/48 (47%), Positives = 34/48 (70%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQ 145
GRAG L++A K+I++MP NS+ +W ALLGAC GD+N+ A ++
Sbjct: 407 GRAGQLEEAYKMIEQMPIPSNSV-VWGALLGACRTHGDINMAERAVQK 453



Score = 30.4 bits (67), Expect(2) = 5e-08
Identities = 16/48 (33%), Positives = 29/48 (60%)
Frame = +3

Query: 168 DGAAYVLMSNIYAAAGMQEDAEKIKSMRFMNKAM*RDRVGSFDTNS*C 311
+G Y+L+S++YAA+G +A +I+ R MN+A + G ++ C
Sbjct: 461 EGGYYILLSDMYAASGRTTEAMEIR--RIMNQAGAQKTAGQSSWSTPC 506


>tr|Q69WY1|Q69WY1_ORYSJ Os06g0613100 protein OS=Oryza sativa subsp.
japonica GN=P0417G12.15 PE=4 SV=1
Length = 615

Score = 46.6 bits (109), Expect(2) = 8e-08
Identities = 20/53 (37%), Positives = 38/53 (71%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR+G L+KA+ +I+ MP F+++ ++W +LLGAC +V+VG ++ L+++
Sbjct: 391 GRSGRLEKALNLIENMP-FESTPSIWGSLLGACRVHANVHVGELVAQKLLEME 442



Score = 32.7 bits (73), Expect(2) = 8e-08
Identities = 13/23 (56%), Positives = 19/23 (82%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
YV++SNIYAAAGM +D K++ +
Sbjct: 449 YVILSNIYAAAGMWKDVFKVRKL 471


>tr|A3BDJ1|A3BDJ1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_021113 PE=4 SV=1
Length = 583

Score = 46.6 bits (109), Expect(2) = 8e-08
Identities = 20/53 (37%), Positives = 38/53 (71%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR+G L+KA+ +I+ MP F+++ ++W +LLGAC +V+VG ++ L+++
Sbjct: 359 GRSGRLEKALNLIENMP-FESTPSIWGSLLGACRVHANVHVGELVAQKLLEME 410



Score = 32.7 bits (73), Expect(2) = 8e-08
Identities = 13/23 (56%), Positives = 19/23 (82%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
YV++SNIYAAAGM +D K++ +
Sbjct: 417 YVILSNIYAAAGMWKDVFKVRKL 439


>tr|A5AJY4|A5AJY4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031840 PE=4 SV=1
Length = 714

Score = 47.8 bits (112), Expect(2) = 1e-07
Identities = 23/53 (43%), Positives = 35/53 (66%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR+G L+ A ++I+ MP + S +W ALLGAC +G+V +G+ EQ L +D
Sbjct: 490 GRSGRLEDAYELIKSMP-MEPSSGVWGALLGACRVYGNVELGKEVAEQLLSLD 541



Score = 31.2 bits (69), Expect(2) = 1e-07
Identities = 12/28 (42%), Positives = 20/28 (71%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKIKSM 248
SD Y+++SNIY+AAG+ A K++ +
Sbjct: 543 SDHRNYIMLSNIYSAAGLWRXASKVRXL 570


>tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 370

Score = 44.3 bits (103), Expect(2) = 1e-07
Identities = 21/52 (40%), Positives = 34/52 (65%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQV 157
GRAG LD+A+ I +MP N+ ++W +LLGAC G++ + A EQ +++
Sbjct: 146 GRAGCLDEALNFINQMPVEPNA-SVWGSLLGACRVHGNIELAERAVEQLIEL 196



Score = 34.7 bits (78), Expect(2) = 1e-07
Identities = 15/23 (65%), Positives = 19/23 (82%)
Frame = +3

Query: 180 YVLMSNIYAAAGMQEDAEKIKSM 248
YVL+SNIYAAAG +DA K++ M
Sbjct: 204 YVLLSNIYAAAGRWDDAGKVRKM 226


>tr|A3BS46|A3BS46_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_025868 PE=4 SV=1
Length = 1010

Score = 48.9 bits (115), Expect(2) = 2e-07
Identities = 24/53 (45%), Positives = 34/53 (64%)
Frame = +2

Query: 2 GRAGHLDKAVKVIQRMPTFDNSIALWSALLGACHKWGDVNVGRWAFEQALQVD 160
GR+G L A + I+RMP + A+W +LL ACH +G+ +GR+A E AL D
Sbjct: 863 GRSGKLHAAKEFIERMP-IKPAAAVWRSLLSACHLFGNAEIGRYAAEMALLAD 914



Score = 28.9 bits (63), Expect(2) = 2e-07
Identities = 11/26 (42%), Positives = 17/26 (65%)
Frame = +3

Query: 165 SDGAAYVLMSNIYAAAGMQEDAEKIK 242
+D YVL+SNIYA+ G+ D ++
Sbjct: 916 TDSGPYVLLSNIYASKGLWADVHNLR 941