BP913480
Clone id YMU001_000030_F12
Library
Length 394
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_F12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATTCGCGGCCGCGAATGTGGAGATATTCAAGGACCAGCGATGCACCCAACTCCAAGGAA
TCTAAAGAGGTTGCTGGAAGCGATCTAGTGAAGCTGCTAATTGGTTTGCAACTAGCTTGC
CCCAGTGATAATACTCAAAAACACTCTGACATTTTCCTTCCAGCAAGTCTTTGTGGGAAG
GCTAGGGAGAGCCTTTTGCCAGGTAAATATCTCAGGCTTAATGATCGCAACGCATCACAT
GTGGGGAGGAGACTGAATGTGAGAGATTCCAAGCGCACATTCCTTACCCCAGGAATTTTT
CCCCGGCTCCAGGTAACATTTCACAACATGCTCACCACCCGAGGTGTAAATGTGGAACTT
GAGCAGGACATCCTAGCGTTTGCCGATGCTGGTT
■■Homology search results ■■ -
sp_hit_id P37197
Definition sp|P37197|YHJA_ECOLI Probable cytochrome c peroxidase OS=Escherichia coli (strain K12)
Align length 41
Score (bit) 32.3
E-value 0.75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913480|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_F12.
(377 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P37197|YHJA_ECOLI Probable cytochrome c peroxidase OS=Escheri... 32 0.75
sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium disco... 30 3.7
sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lac... 29 8.3

>sp|P37197|YHJA_ECOLI Probable cytochrome c peroxidase
OS=Escherichia coli (strain K12) GN=yhjA PE=4 SV=1
Length = 465

Score = 32.3 bits (72), Expect = 0.75
Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
Frame = -3

Query: 288 RGKIPGVRNVRLESLTFSL--LPTCDALRSLSLRYLPGKRL 172
R K+PG+RNV L + F +PT D L LRY GK L
Sbjct: 398 RQKVPGLRNVALTAPYFHRGDVPTLDGAVKLMLRYQVGKEL 438


>sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum
GN=mhcA PE=1 SV=3
Length = 2116

Score = 30.0 bits (66), Expect = 3.7
Identities = 16/39 (41%), Positives = 21/39 (53%)
Frame = +2

Query: 146 ASLCGKARESLLPGKYLRLNDRNASHVGRRLNVRDSKRT 262
A L +A L G+Y LN++ S V R NV SK+T
Sbjct: 1053 AKLAQEAANKKLQGEYTELNEKFNSEVTARSNVEKSKKT 1091


>sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lactis
GN=BST1 PE=3 SV=1
Length = 975

Score = 28.9 bits (63), Expect = 8.3
Identities = 19/65 (29%), Positives = 25/65 (38%)
Frame = -2

Query: 283 KNSWGKECALGISHIQSPPHM*CVAIIKPEIFTWQKALPSLPTKTCWKENVRVFLSIITG 104
K+ +GK+C G S PH +L PT + W E+V F I
Sbjct: 443 KDIYGKDCINGFSSFSKVPH--------------STSLQKFPTDSSWGESVSPFRFISLN 488

Query: 103 AS*LQ 89
S LQ
Sbjct: 489 GSLLQ 493


tr_hit_id A9SDC3
Definition tr|A9SDC3|A9SDC3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 122
Score (bit) 54.3
E-value 3.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913480|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_F12.
(377 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SDC3|A9SDC3_PHYPA Predicted protein OS=Physcomitrella paten... 54 3e-06
tr|Q9FJ57|Q9FJ57_ARATH Gb|AAD39572.1 OS=Arabidopsis thaliana GN=... 50 4e-05
tr|A9TX66|A9TX66_PHYPA Predicted protein OS=Physcomitrella paten... 50 6e-05
tr|A5C204|A5C204_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A7P0F5|A7P0F5_VITVI Chromosome chr19 scaffold_4, whole genome... 44 0.005
tr|Q75LL9|Q75LL9_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 39 0.13
tr|A3AMR2|A3AMR2_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.13
tr|A0CC47|A0CC47_PARTE Chromosome undetermined scaffold_166, who... 37 0.63
tr|A4H564|A4H564_LEIBR Putative uncharacterized protein OS=Leish... 35 2.4
tr|A7SP94|A7SP94_NEMVE Predicted protein (Fragment) OS=Nematoste... 33 7.0
tr|A6FJ28|A6FJ28_9GAMM Predicted membrane protein OS=Moritella s... 33 9.2

>tr|A9SDC3|A9SDC3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164300 PE=4 SV=1
Length = 1670

Score = 54.3 bits (129), Expect = 3e-06
Identities = 39/122 (31%), Positives = 62/122 (50%), Gaps = 12/122 (9%)
Frame = +2

Query: 47 KEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLCGKARESLL-------PGKYLRLN 205
K V DLV+L++ L L + K S +++PA+L + E+ P +Y +++
Sbjct: 1078 KGVVTEDLVQLMVKLNLCFEQNPGDKTSGVYIPAALHKPSEEAARGERPLSWPCRYGQVS 1137

Query: 206 DRNASHVGRRLNVRDSKRTFLTPGIFPRLQVTFHNMLTTRGVNVE-----LEQDILAFAD 370
+ + +HVG RL + + T LT G FPRLQV L R V V E+D ++F
Sbjct: 1138 EHDLTHVGWRLKCENPELTTLTRGFFPRLQV----FLQRRFVGVSDACYTFEKDFISFVF 1193

Query: 371 AG 376
+G
Sbjct: 1194 SG 1195


>tr|Q9FJ57|Q9FJ57_ARATH Gb|AAD39572.1 OS=Arabidopsis thaliana
GN=At5g55540 PE=4 SV=1
Length = 1380

Score = 50.4 bits (119), Expect = 4e-05
Identities = 35/118 (29%), Positives = 53/118 (44%), Gaps = 4/118 (3%)
Frame = +2

Query: 35 SKESKEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLCGKARESLLPGKYLRLNDRN 214
SK + DLVK++ ++L D + S + +P+ L E + ++N +
Sbjct: 841 SKVLEHFDACDLVKMMKKVELCYEQDPSSPDSSLLVPSIL----EEGRGKTQKWQINTHD 896

Query: 215 ASHVGRRLNVRDSKRTFLTPGIFPRLQVTFHNML----TTRGVNVELEQDILAFADAG 376
+ GR L DS FLT G FPRLQV HN + G LE+ ++A G
Sbjct: 897 CVYSGRHLQCDDSSHMFLTAGFFPRLQVHLHNRIMELKNQHGATYSLEKYLIAITIHG 954


>tr|A9TX66|A9TX66_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_172493 PE=4 SV=1
Length = 1705

Score = 50.1 bits (118), Expect = 6e-05
Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 9/122 (7%)
Frame = +2

Query: 38 KESKEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLCGKARESLLPGK--------Y 193
++ + V DLV+L++ L L + K S I++PASL + E+ G+ Y
Sbjct: 1172 RKVRGVIPEDLVQLMVKLNLCFEQNPGDKTSGIYIPASLSNPS-EAAARGERPLSWANGY 1230

Query: 194 LRLNDRNASHVGRRLNVRDSKRTFLTPGIFPRLQVTFHNMLT-TRGVNVELEQDILAFAD 370
+++D HVG RL + + T LT G FPRLQV + + +E++ ++F
Sbjct: 1231 DQVSDDELLHVGWRLKCENPELTTLTLGFFPRLQVFLQKKFSGVQDARYTIEKNFISFVF 1290

Query: 371 AG 376
+G
Sbjct: 1291 SG 1292


>tr|A5C204|A5C204_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003518 PE=4 SV=1
Length = 1400

Score = 45.1 bits (105), Expect = 0.002
Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
Frame = +2

Query: 35 SKESKEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLC-GKARESLLPGKYLRLNDR 211
SK + + SDLV++++ L+L D + +S + +P+ L G+ R P ++ +L
Sbjct: 844 SKVFENLEASDLVRMMLKLELCYEQDPSDPNSLLLIPSILEEGRGR----PQRW-QLIAP 898

Query: 212 NASHVGRRLNVRDSKRTFLTPGIFPR---LQVTFHN 310
+ + GR L DS FLTPG FPR QV HN
Sbjct: 899 DCVYSGRHLECDDSSHMFLTPGFFPRCTQAQVHLHN 934


>tr|A7P0F5|A7P0F5_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027211001
PE=4 SV=1
Length = 1362

Score = 43.5 bits (101), Expect = 0.005
Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
Frame = +2

Query: 35 SKESKEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLC-GKARESLLPGKYLRLNDR 211
SK + + SDLV++++ L+L D + +S + +P+ L G+ R P ++ +L
Sbjct: 833 SKVFENLEASDLVRMMLKLELCYEQDPSDPNSLLLIPSILEEGRGR----PQRW-QLIAP 887

Query: 212 NASHVGRRLNVRDSKRTFLTPGIFPRLQVTFHN 310
+ + GR L DS FLTPG FP QV HN
Sbjct: 888 DCVYSGRHLECDDSSHMFLTPGFFPP-QVHLHN 919


>tr|Q75LL9|Q75LL9_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0047E24.18 PE=4 SV=1
Length = 1239

Score = 38.9 bits (89), Expect = 0.13
Identities = 27/99 (27%), Positives = 44/99 (44%)
Frame = +2

Query: 32 NSKESKEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLCGKARESLLPGKYLRLNDR 211
N + + D++ +L+ L+L D ++ + +PA L ES + +L
Sbjct: 800 NWRAGASLQSGDIINMLLKLELCYEQDPGNPNTLLLVPAML----EESKEGIQRWQLTMP 855

Query: 212 NASHVGRRLNVRDSKRTFLTPGIFPRLQVTFHNMLTTRG 328
+ GR + D+ FLT FPRLQV HN + G
Sbjct: 856 ECRYAGRHMECEDT-HMFLTNDFFPRLQVRLHNKIMCPG 893


>tr|A3AMR2|A3AMR2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_012084 PE=4 SV=1
Length = 1218

Score = 38.9 bits (89), Expect = 0.13
Identities = 27/99 (27%), Positives = 44/99 (44%)
Frame = +2

Query: 32 NSKESKEVAGSDLVKLLIGLQLACPSDNTQKHSDIFLPASLCGKARESLLPGKYLRLNDR 211
N + + D++ +L+ L+L D ++ + +PA L ES + +L
Sbjct: 779 NWRAGASLQSGDIINMLLKLELCYEQDPGNPNTLLLVPAML----EESKEGIQRWQLTMP 834

Query: 212 NASHVGRRLNVRDSKRTFLTPGIFPRLQVTFHNMLTTRG 328
+ GR + D+ FLT FPRLQV HN + G
Sbjct: 835 ECRYAGRHMECEDT-HMFLTNDFFPRLQVRLHNKIMCPG 872


>tr|A0CC47|A0CC47_PARTE Chromosome undetermined scaffold_166, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00037148001 PE=4 SV=1
Length = 357

Score = 36.6 bits (83), Expect = 0.63
Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 11/71 (15%)
Frame = +2

Query: 176 LLPGKYLRLNDRNASHVGRRLNVRDSKRTFLTPGIFPRLQVT-----------FHNMLTT 322
L P + +++ D S +G+ N+R +L P +F +T FH MLT
Sbjct: 229 LTPNQTVKIFDFGLSQIGQNTNIRSGTGGYLAPEVFQNQPITSKSDIFSLGVIFHKMLTG 288

Query: 323 RGVNVELEQDI 355
+G+ LE+++
Sbjct: 289 KGIFKNLEENM 299


>tr|A4H564|A4H564_LEIBR Putative uncharacterized protein OS=Leishmania
braziliensis GN=LbrM07_V2.1230 PE=4 SV=1
Length = 2543

Score = 34.7 bits (78), Expect = 2.4
Identities = 17/52 (32%), Positives = 27/52 (51%)
Frame = -2

Query: 316 EHVVKCYLEPGKNSWGKECALGISHIQSPPHM*CVAIIKPEIFTWQKALPSL 161
E VV+C G + GKE L +SH S + + + +P +FT ++ P L
Sbjct: 958 ECVVRCGAAEGHTTSGKELLLSVSHTASEERVAALDVYRPHLFTTRENFPVL 1009


>tr|A7SP94|A7SP94_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g125841 PE=4 SV=1
Length = 236

Score = 33.1 bits (74), Expect = 7.0
Identities = 11/31 (35%), Positives = 21/31 (67%)
Frame = -2

Query: 199 PEIFTWQKALPSLPTKTCWKENVRVFLSIIT 107
P FTW++ +P +PT+ W++NV+ + +T
Sbjct: 130 PTRFTWRQNVPPIPTRVSWRQNVQPIPTRVT 160