BP913481
Clone id YMU001_000030_G01
Library
Length 300
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCTATCCACCACAATTCCATATTATGAATTGTAGTTAGCCACCACGAACTTCCGGCCTGC
CTTATCGGCCTTCACTGTCGCGACATCCTCCAACTTTGCAAAGAGCAAATCAAGCTCTTC
GACTCCAAAAGCTGCACAATCTAACTCATGCGCATACCTCTGCCTATACAATGCTTCAAA
GTTCAAAAGAGGAATTGCACAAGCATGACTCACCAAGAGCTCTTGCACTTCCTGCTTCAA
GACTTCTAGCATTACTTCTGCCATGTACGCATCTCCATCCGAAGCCTCTCCTTCTTCATT
■■Homology search results ■■ -
sp_hit_id Q9NZM4
Definition sp|Q9NZM4|GSCR1_HUMAN Glioma tumor suppressor candidate region gene 1 protein OS=Homo sapiens
Align length 59
Score (bit) 32.7
E-value 0.58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913481|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_G01.
(300 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9NZM4|GSCR1_HUMAN Glioma tumor suppressor candidate region g... 33 0.58
sp|Q9ULH0|ARMS_HUMAN Ankyrin repeat-rich membrane spanning prote... 30 2.9
sp|Q5T848|GP158_HUMAN Probable G-protein coupled receptor 158 OS... 30 5.0
sp|Q8VIG2|LKAP_RAT Limkain-b1 OS=Rattus norvegicus GN=Lkap PE=1 ... 29 8.4

>sp|Q9NZM4|GSCR1_HUMAN Glioma tumor suppressor candidate region gene 1
protein OS=Homo sapiens GN=GLTSCR1 PE=1 SV=2
Length = 1560

Score = 32.7 bits (73), Expect = 0.58
Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
Frame = +3

Query: 39 PPRTSGLPYRPSLS--RHPPTLQRANQALRLQKLHNLTHA--HTSAYTMLQSSKEELHK 203
P + SGL Y LS + PPTLQ + +A L+ LH + H T S ++ LH+
Sbjct: 1055 PGKPSGLQYESKLSGLKKPPTLQPSKEACFLEHLHKHQGSVLHPDYKTAFPSFEDALHR 1113


>sp|Q9ULH0|ARMS_HUMAN Ankyrin repeat-rich membrane spanning protein
OS=Homo sapiens GN=ARMS PE=1 SV=3
Length = 1771

Score = 30.4 bits (67), Expect = 2.9
Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
Frame = +3

Query: 48 TSGLPYRPSLSRHPPTLQRANQALRLQKLHNLTH--AHTSAYTMLQSSKEELH 200
TS + RPS S +P T+Q N L ++TH + S+YT L ELH
Sbjct: 1708 TSQVILRPSSSPNPTTIQNEN-------LKSMTHKRSQRSSYTRLSKDPPELH 1753


>sp|Q5T848|GP158_HUMAN Probable G-protein coupled receptor 158
OS=Homo sapiens GN=GPR158 PE=2 SV=1
Length = 1215

Score = 29.6 bits (65), Expect = 5.0
Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
Frame = +3

Query: 27 NCS*PPRTSGLPYR-PSLSRHPPTLQRANQALRLQKLHNLTHAHTSAYTMLQSSK 188
NCS +GLP + P+L+ P+L RA L LTHA MLQS+K
Sbjct: 98 NCSGRYELAGLPGKWPALASAHPSLHRA--------LDTLTHATNFLNVMLQSNK 144


>sp|Q8VIG2|LKAP_RAT Limkain-b1 OS=Rattus norvegicus GN=Lkap PE=1 SV=1
Length = 1735

Score = 28.9 bits (63), Expect = 8.4
Identities = 16/51 (31%), Positives = 26/51 (50%)
Frame = -1

Query: 204 ACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADKAGR 52
AC +PL F +Y ++Y H+L+ + DL KL D+ ++ GR
Sbjct: 889 ACCLPLFKFIDIYEKKYGHKLNVS-------DLY--KLTDMIAIREQGNGR 930


tr_hit_id B8LKC8
Definition tr|B8LKC8|B8LKC8_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 61
Score (bit) 60.1
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913481|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_G01.
(300 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LKC8|B8LKC8_PICSI Putative uncharacterized protein OS=Picea... 60 5e-08
tr|Q6ZCR7|Q6ZCR7_ORYSJ Os08g0230500 protein OS=Oryza sativa subs... 53 7e-06
tr|B8BC63|B8BC63_ORYSI Putative uncharacterized protein OS=Oryza... 53 7e-06
tr|B6SXX4|B6SXX4_MAIZE Putative uncharacterized protein OS=Zea m... 53 9e-06
tr|A7P9L0|A7P9L0_VITVI Chromosome chr3 scaffold_8, whole genome ... 47 6e-04
tr|A5AX04|A5AX04_VITVI Putative uncharacterized protein OS=Vitis... 47 6e-04
tr|A9S8X5|A9S8X5_PHYPA Predicted protein OS=Physcomitrella paten... 39 0.098
tr|A3BQW0|A3BQW0_ORYSJ Putative uncharacterized protein OS=Oryza... 37 0.37
tr|A9SRF2|A9SRF2_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.63
tr|A9REC6|A9REC6_PHYPA Predicted protein OS=Physcomitrella paten... 35 1.4
tr|A8NUT6|A8NUT6_COPC7 Predicted protein OS=Coprinopsis cinerea ... 33 7.0

>tr|B8LKC8|B8LKC8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 593

Score = 60.1 bits (144), Expect = 5e-08
Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
Frame = -1

Query: 210 SHACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADKAG--RKFVVA 37
SHAC I L F LY+QR+A ELD + FGV+EL+ L K+ DVA ++ + G RK ++A
Sbjct: 530 SHACKILLSRFSTLYQQRFAKELDYSIFGVQELEALIEKVRDVAVIEEEHDGTDRKILIA 589

Query: 36 N 34
N
Sbjct: 590 N 590


>tr|Q6ZCR7|Q6ZCR7_ORYSJ Os08g0230500 protein OS=Oryza sativa subsp.
japonica GN=P0461A06.6 PE=4 SV=1
Length = 530

Score = 53.1 bits (126), Expect = 7e-06
Identities = 26/62 (41%), Positives = 41/62 (66%), Gaps = 1/62 (1%)
Frame = -1

Query: 207 HACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADKAG-RKFVVANY 31
++C +PL NF++LY QRY L +FGV+ L+ L K++DV + D+ RK+++ANY
Sbjct: 469 YSCPVPLGNFKSLYEQRYKKTLIYESFGVDGLEELVEKVKDVVELCEDQTSKRKYLIANY 528

Query: 30 NS 25
S
Sbjct: 529 RS 530


>tr|B8BC63|B8BC63_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_28326 PE=4 SV=1
Length = 523

Score = 53.1 bits (126), Expect = 7e-06
Identities = 26/62 (41%), Positives = 41/62 (66%), Gaps = 1/62 (1%)
Frame = -1

Query: 207 HACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADKAG-RKFVVANY 31
++C +PL NF++LY QRY L +FGV+ L+ L K++DV + D+ RK+++ANY
Sbjct: 462 YSCPVPLGNFKSLYEQRYKKTLIYESFGVDGLEELVEKVKDVVELCEDQTSKRKYLIANY 521

Query: 30 NS 25
S
Sbjct: 522 RS 523


>tr|B6SXX4|B6SXX4_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 531

Score = 52.8 bits (125), Expect = 9e-06
Identities = 25/62 (40%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
Frame = -1

Query: 207 HACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADKAGR-KFVVANY 31
++C +PL NFE+LY QRY +D + GV L+ L K++DV + D+ + KF++ANY
Sbjct: 469 YSCPVPLGNFESLYEQRYKKIIDYESLGVTGLEELVEKVKDVVDLHEDQTSKSKFLIANY 528

Query: 30 NS 25
+
Sbjct: 529 TT 530


>tr|A7P9L0|A7P9L0_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036609001
PE=4 SV=1
Length = 531

Score = 46.6 bits (109), Expect = 6e-04
Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
Frame = -1

Query: 210 SHACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADK-AGRKFVVA 37
S++C I L FEA+Y+QRY LD FGV EL+ LF K++DV + + RKF+ A
Sbjct: 470 SYSCRIFLGCFEAIYQQRYKKPLDYRKFGVNELEGLFDKVKDVVVLHEEPVTKRKFLDA 528


>tr|A5AX04|A5AX04_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_001778 PE=4 SV=1
Length = 531

Score = 46.6 bits (109), Expect = 6e-04
Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
Frame = -1

Query: 210 SHACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKLEDVATVKADK-AGRKFVVA 37
S++C I L FEA+Y+QRY LD FGV EL+ LF K++DV + + RKF+ A
Sbjct: 470 SYSCRIFLGCFEAIYQQRYKKPLDYRKFGVNELEGLFDKVKDVVVLHEEPVTKRKFLDA 528


>tr|A9S8X5|A9S8X5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_125967 PE=4 SV=1
Length = 474

Score = 39.3 bits (90), Expect = 0.098
Identities = 18/35 (51%), Positives = 25/35 (71%)
Frame = -1

Query: 195 IPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKL 91
IP NF +Y+QRYA LD ++FGVE ++ L AK+
Sbjct: 432 IPYENFIRVYQQRYARTLDLSSFGVESVNSLLAKV 466


>tr|A3BQW0|A3BQW0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_025432 PE=4 SV=1
Length = 559

Score = 37.4 bits (85), Expect = 0.37
Identities = 17/38 (44%), Positives = 25/38 (65%)
Frame = -1

Query: 207 HACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAK 94
++C +PL NF++LY QRY L +FGV+ L+ L K
Sbjct: 462 YSCPVPLGNFKSLYEQRYKKTLIYESFGVDGLEELVEK 499


>tr|A9SRF2|A9SRF2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_134054 PE=4 SV=1
Length = 431

Score = 36.6 bits (83), Expect = 0.63
Identities = 17/39 (43%), Positives = 23/39 (58%)
Frame = -1

Query: 207 HACAIPLLNFEALYRQRYAHELDCAAFGVEELDLLFAKL 91
+A IPL F +Y+QRY LD GV+ L+ LF K+
Sbjct: 387 YALEIPLKQFVKIYQQRYTRVLDLQNLGVDSLETLFQKV 425


>tr|A9REC6|A9REC6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_112426 PE=4 SV=1
Length = 465

Score = 35.4 bits (80), Expect = 1.4
Identities = 14/31 (45%), Positives = 22/31 (70%)
Frame = -1

Query: 183 NFEALYRQRYAHELDCAAFGVEELDLLFAKL 91
+F +Y+QRY LD ++FGV+ +D L AK+
Sbjct: 431 DFNRVYKQRYGRNLDFSSFGVDSMDSLVAKV 461