BP913489
Clone id YMU001_000030_G09
Library
Length 512
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000030_G09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATAAGAATGCCTAGATTATCAATATAAAGTACATTTTGTTGATAAAAATTGGGCTCAAA
TAGCTACTTTTTGAACTAAGATATTTTGTCATGAGTTTTATAATCGACCGCTATTATGCC
CCTCTATAGGAAATTGAATGCCATCGAGATAAGAGTTACGAGTGGCATCATTTAGGCACT
TGTGGTTGCCAATGATTAATGAAATTAAAAGGTACCATTGGAGGTTCCCTCAGCTGTAGG
ATCGTTTGTAGATCATGTGCATACTAAACTTCATCAGCCATTATTTCTCGAACGTAAGGT
AATATCCATTGCTGGCTTGAGTAGATCCCAAGTAGGGTCCGAGGAGGCTTCGTGTGTTGG
AGAAGCCAGGCGAAGAGCATAGCAGGCGGGCAAGGCAGGCAGGATGTGGGCGAGCTCGGG
GATGGACTCCTCATCAAAAGCAAAGCCCAACTCAATGCAACCTTTGAGCTCTTCAAAGTC
ATCATCTGTGAGGCTGNCCATGTGGGCGAGCC
■■Homology search results ■■ -
sp_hit_id A5ILH3
Definition sp|A5ILH3|PPNK_THEP1 Probable inorganic polyphosphate/ATP-NAD kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995)
Align length 41
Score (bit) 30.4
E-value 5.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913489|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_G09.
(512 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A5ILH3|PPNK_THEP1 Probable inorganic polyphosphate/ATP-NAD ki... 30 5.0
sp|Q9X255|PPNK_THEMA Probable inorganic polyphosphate/ATP-NAD ki... 30 5.0
sp|P21322|YR7H_ECOLX Putative uncharacterized protein ORFH in re... 30 6.5
sp|B0C308|DNLJ_ACAM1 DNA ligase OS=Acaryochloris marina (strain ... 30 8.5

>sp|A5ILH3|PPNK_THEP1 Probable inorganic polyphosphate/ATP-NAD
kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC
BAA-488 / DSM 13995) GN=ppnK PE=3 SV=1
Length = 258

Score = 30.4 bits (67), Expect = 5.0
Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
Frame = -2

Query: 220 QWYLLISLIIGNHKCLNDATRNSYLDG----IQFPIEGHNS 110
+W++ I +GNH LND T L G I+ +E H+S
Sbjct: 103 RWFIQIESELGNHLALNDVTLERDLSGKMVEIEVEVEHHSS 143


>sp|Q9X255|PPNK_THEMA Probable inorganic polyphosphate/ATP-NAD
kinase OS=Thermotoga maritima GN=ppnK PE=1 SV=1
Length = 258

Score = 30.4 bits (67), Expect = 5.0
Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
Frame = -2

Query: 220 QWYLLISLIIGNHKCLNDATRNSYLDG----IQFPIEGHNS 110
+W++ I +GNH LND T L G I+ +E H+S
Sbjct: 103 RWFIQIESELGNHLALNDVTLERDLSGKMVEIEVEVEHHSS 143


>sp|P21322|YR7H_ECOLX Putative uncharacterized protein ORFH in
retron EC67 OS=Escherichia coli PE=4 SV=1
Length = 104

Score = 30.0 bits (66), Expect = 6.5
Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 7/57 (12%)
Frame = -3

Query: 450 LGFAFDEESIPELAHILPALPACYALRLASPTHE-----ASSDPTWD--LLKPAMDI 301
+G A ES H+LP P C A+R+ H+ + TW L+ P M++
Sbjct: 1 MGSACSAESAHSCQHVLPVAPGCGAMRMHDRLHQNVDVWKLGNQTWSTPLMYPKMEL 57


>sp|B0C308|DNLJ_ACAM1 DNA ligase OS=Acaryochloris marina (strain
MBIC 11017) GN=ligA PE=3 SV=1
Length = 675

Score = 29.6 bits (65), Expect = 8.5
Identities = 20/69 (28%), Positives = 30/69 (43%)
Frame = +1

Query: 247 CRSCAY*TSSAIISRT*GNIHCWLE*IPSRVRGGFVCWRSQAKSIAGGQGRQDVGELGDG 426
C SC A+ T C P+ +RG + W S+ G G + VG+L D
Sbjct: 416 CPSCG---QPAVQLETEAVTRCVNASCPAILRGSLIHWVSRGALDIDGLGEKIVGQLTDS 472

Query: 427 LLIKSKAQL 453
+++S A L
Sbjct: 473 QMVQSVADL 481


tr_hit_id Q94JW9
Definition tr|Q94JW9|Q94JW9_ARATH Putative uncharacterized protein At2g43340; T1O24.8 (Putative uncharacterized protein At2g43340) (At2g43340) OS=Arabidopsis thaliana
Align length 63
Score (bit) 63.9
E-value 4.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913489|Adiantum capillus-veneris mRNA, clone:
YMU001_000030_G09.
(512 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q94JW9|Q94JW9_ARATH Putative uncharacterized protein At2g4334... 64 4e-09
tr|O22849|O22849_ARATH Putative uncharacterized protein At2g4334... 64 4e-09
tr|Q9SIQ1|Q9SIQ1_ARATH Putative uncharacterized protein At2g3156... 62 2e-08
tr|Q8VZ71|Q8VZ71_ARATH Putative uncharacterized protein At2g3156... 62 2e-08
tr|Q53NY5|Q53NY5_ORYSJ Os11g0282300 protein OS=Oryza sativa subs... 60 5e-08
tr|Q2QVG6|Q2QVG6_ORYSJ Os12g0230600 protein OS=Oryza sativa subs... 60 5e-08
tr|A3CG27|A3CG27_ORYSJ Putative uncharacterized protein OS=Oryza... 60 5e-08
tr|A3CAH5|A3CAH5_ORYSJ Putative uncharacterized protein OS=Oryza... 60 5e-08
tr|A7QM48|A7QM48_VITVI Chromosome chr5 scaffold_124, whole genom... 60 6e-08
tr|A5AU09|A5AU09_VITVI Putative uncharacterized protein OS=Vitis... 60 6e-08
tr|Q9MA39|Q9MA39_ARATH T20M3.14 protein (At1g05870) OS=Arabidops... 60 8e-08
tr|B4F878|B4F878_MAIZE Putative uncharacterized protein OS=Zea m... 60 8e-08
tr|B6TXA4|B6TXA4_MAIZE Putative uncharacterized protein OS=Zea m... 59 1e-07
tr|B6TMR9|B6TMR9_MAIZE Putative uncharacterized protein OS=Zea m... 58 2e-07
tr|A3A0J9|A3A0J9_ORYSJ Putative uncharacterized protein OS=Oryza... 57 4e-07
tr|Q8S0D8|Q8S0D8_ORYSJ Putative uncharacterized protein P0506A10... 56 9e-07
tr|Q0JGW8|Q0JGW8_ORYSJ Os01g0898800 protein OS=Oryza sativa subs... 56 1e-06
tr|B8A7Q7|B8A7Q7_ORYSI Putative uncharacterized protein OS=Oryza... 56 1e-06
tr|B8LL54|B8LL54_PICSI Putative uncharacterized protein OS=Picea... 55 3e-06
tr|Q9ZQF4|Q9ZQF4_ARATH Putative uncharacterized protein At2g1559... 49 1e-04
tr|Q8H1M4|Q8H1M4_ARATH Putative uncharacterized protein At2g1559... 49 1e-04
tr|Q9SR04|Q9SR04_ARATH F7O18.17 protein (At3g04700) OS=Arabidops... 49 2e-04
tr|A7QMQ9|A7QMQ9_VITVI Chromosome undetermined scaffold_127, who... 49 2e-04
tr|A5APB7|A5APB7_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|Q6NQD5|Q6NQD5_ARATH At5g28690 (Putative uncharacterized prote... 48 3e-04
tr|Q8L8Y8|Q8L8Y8_ARATH Putative uncharacterized protein OS=Arabi... 47 4e-04
tr|Q84WK9|Q84WK9_ARATH At4g33985 OS=Arabidopsis thaliana PE=2 SV=1 47 4e-04
tr|Q0WS40|Q0WS40_ARATH Putative uncharacterized protein At4g3399... 47 4e-04
tr|B8BJW2|B8BJW2_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|B8BEW9|B8BEW9_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04

>tr|Q94JW9|Q94JW9_ARATH Putative uncharacterized protein At2g43340;
T1O24.8 (Putative uncharacterized protein At2g43340)
(At2g43340) OS=Arabidopsis thaliana GN=At2g43340/T1O24.8
PE=2 SV=1
Length = 189

Score = 63.9 bits (154), Expect = 4e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 4/63 (6%)
Frame = -3

Query: 510 LAHMXSLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYALRL----ASPTHEAS 343
L SLTDDD EELKGC++LGF F+ E IPEL + LPAL CY++ H +S
Sbjct: 79 LKRTKSLTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDQDHHHHSS 138

Query: 342 SDP 334
S P
Sbjct: 139 SSP 141


>tr|O22849|O22849_ARATH Putative uncharacterized protein At2g43340
OS=Arabidopsis thaliana GN=At2g43340 PE=2 SV=1
Length = 241

Score = 63.9 bits (154), Expect = 4e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 4/63 (6%)
Frame = -3

Query: 510 LAHMXSLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYALRL----ASPTHEAS 343
L SLTDDD EELKGC++LGF F+ E IPEL + LPAL CY++ H +S
Sbjct: 79 LKRTKSLTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDQDHHHHSS 138

Query: 342 SDP 334
S P
Sbjct: 139 SSP 141


>tr|Q9SIQ1|Q9SIQ1_ARATH Putative uncharacterized protein At2g31560
OS=Arabidopsis thaliana GN=At2g31560 PE=4 SV=1
Length = 202

Score = 62.0 bits (149), Expect = 2e-08
Identities = 27/46 (58%), Positives = 33/46 (71%)
Frame = -3

Query: 510 LAHMXSLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
L SLTDDD EELKGC++LGF F + IPEL + LPAL CY++
Sbjct: 92 LTRAKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSM 137


>tr|Q8VZ71|Q8VZ71_ARATH Putative uncharacterized protein At2g31560
(At2g31560) OS=Arabidopsis thaliana GN=At2g31560 PE=2
SV=1
Length = 202

Score = 62.0 bits (149), Expect = 2e-08
Identities = 27/46 (58%), Positives = 33/46 (71%)
Frame = -3

Query: 510 LAHMXSLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
L SLTDDD EELKGC++LGF F + IPEL + LPAL CY++
Sbjct: 92 LTRAKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSM 137


>tr|Q53NY5|Q53NY5_ORYSJ Os11g0282300 protein OS=Oryza sativa subsp.
japonica GN=Os11g0282300 PE=4 SV=1
Length = 232

Score = 60.5 bits (145), Expect = 5e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -3

Query: 495 SLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
SLTDDD EELKGC++LGF F + IPEL LPAL CY++
Sbjct: 130 SLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSM 170


>tr|Q2QVG6|Q2QVG6_ORYSJ Os12g0230600 protein OS=Oryza sativa subsp.
japonica GN=Os12g0230600 PE=2 SV=1
Length = 215

Score = 60.5 bits (145), Expect = 5e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -3

Query: 495 SLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
SLTDDD EELKGC++LGF F + IPEL LPAL CY++
Sbjct: 114 SLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSM 154


>tr|A3CG27|A3CG27_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034249 PE=4 SV=1
Length = 183

Score = 60.5 bits (145), Expect = 5e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -3

Query: 495 SLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
SLTDDD EELKGC++LGF F + IPEL LPAL CY++
Sbjct: 82 SLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSM 122


>tr|A3CAH5|A3CAH5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_032297 PE=4 SV=1
Length = 232

Score = 60.5 bits (145), Expect = 5e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -3

Query: 495 SLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
SLTDDD EELKGC++LGF F + IPEL LPAL CY++
Sbjct: 130 SLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSM 170


>tr|A7QM48|A7QM48_VITVI Chromosome chr5 scaffold_124, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001921001
PE=4 SV=1
Length = 357

Score = 60.1 bits (144), Expect = 6e-08
Identities = 26/46 (56%), Positives = 33/46 (71%)
Frame = -3

Query: 510 LAHMXSLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
L SLTD+D +ELKGC++LGF F E IPEL + LPAL CY++
Sbjct: 81 LMRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSM 126


>tr|A5AU09|A5AU09_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034776 PE=4 SV=1
Length = 295

Score = 60.1 bits (144), Expect = 6e-08
Identities = 26/46 (56%), Positives = 33/46 (71%)
Frame = -3

Query: 510 LAHMXSLTDDDFEELKGCIELGFAFDEESIPELAHILPALPACYAL 373
L SLTD+D +ELKGC++LGF F E IPEL + LPAL CY++
Sbjct: 81 LMRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSM 126