BP913512
Clone id YMU001_000031_A10
Library
Length 566
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTGGTTTTTTTTTGTGGACATTATCATGCCTTCTCATTTTCCACACATAGATACAATTG
AGAAATAGAGTTTAGAGTTCCGATCATCCATTGCCCTCACTACACTCACCACTCATACCT
TTGTACACCTACCATGCCCATCCACATCCACCCTATTCTCTATTCTCTTTGGCGTCCACA
AGCGGCAAACAAATCTGTCTTTGTTTCTTAACATTATAAGCAAACATGTCGATACAATTG
CAGACTTAGGCAAAAGTGCTGAGACCAAGATTTACACGATACCATCAAGTTTCAATCAAC
CTGGAGAAGCTCTTCCAAGGTTGAGACACACTCAACGTGGAGAAGCTCTTCCAAGGCGGA
GACACACTCTTTGCGTACTCCATGTCCACACTTGCTAGAATTTGTGGAATCTATTATCTG
AGAGAGCTGCATCTCGATGCGGCGAACACGCACTAATAAACTGCCTTTCTGCTCCACCTC
TTCCATCACCTCTTCTGCAGGCTTACATCGCGTCTCCATAGAGTTGCTCATCCACCTTCT
GCAAGGGCGGTTGCCCTCCATAATCA
■■Homology search results ■■ -
sp_hit_id Q74ND5
Definition sp|Q74ND5|SYP_NANEQ Prolyl-tRNA synthetase OS=Nanoarchaeum equitans
Align length 74
Score (bit) 33.1
E-value 0.98
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913512|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_A10.
(566 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q74ND5|SYP_NANEQ Prolyl-tRNA synthetase OS=Nanoarchaeum equit... 33 0.98
sp|Q54X49|METE_DICDI 5-methyltetrahydropteroyltriglutamate--homo... 31 4.9
sp|P03234|VP40_EBV Capsid protein P40 OS=Epstein-Barr virus (str... 30 6.4
sp|Q8XJ01|PBPA_CLOPE Penicillin-binding protein 1A OS=Clostridiu... 30 6.4
sp|Q0TNZ8|PBPA_CLOP1 Penicillin-binding protein 1A OS=Clostridiu... 30 6.4
sp|A3LNC4|U507_PICST UPF0507 protein PICST_55861 OS=Pichia stipi... 30 8.3
sp|P40026|KRE29_YEAST DNA repair protein KRE29 OS=Saccharomyces ... 30 8.3
sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis el... 30 8.3
sp|Q9CZH8|CCD77_MOUSE Coiled-coil domain-containing protein 77 O... 30 8.3

>sp|Q74ND5|SYP_NANEQ Prolyl-tRNA synthetase OS=Nanoarchaeum equitans
GN=proS PE=3 SV=1
Length = 537

Score = 33.1 bits (74), Expect = 0.98
Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 5/74 (6%)
Frame = -3

Query: 525 NSMETRCKPAEEVMEEVEQKGS-----LLVRVRRIEMQLSQIIDSTNSSKCGHGVRKECV 361
N +E + +E+ E+++QK ++VRV+ + +L + I+ +K +R+ C
Sbjct: 436 NELEKIDQIFKEMEEDLKQKAKSFVNDMVVRVKTFD-ELKEAIEQNKIAKAPFCMRESCA 494

Query: 360 SALEELLHVECVST 319
+ ++ELLH E T
Sbjct: 495 NQIKELLHAEVRGT 508


>sp|Q54X49|METE_DICDI
5-methyltetrahydropteroyltriglutamate--homocysteine
methyltransferase OS=Dictyostelium discoideum GN=metE
PE=3 SV=1
Length = 825

Score = 30.8 bits (68), Expect = 4.9
Identities = 15/57 (26%), Positives = 27/57 (47%)
Frame = +3

Query: 123 VHLPCPSTSTLFSILFGVHKRQTNLSLFLNIISKHVDTIADLGKSAETKIYTIPSSF 293
+H P+ + L + FG + +L L + H+DTI E+ + IP+S+
Sbjct: 272 IHKAAPNINILIATYFGEIRENIDLITSLPVNGIHIDTIRSSSSEVESVLTKIPTSW 328


>sp|P03234|VP40_EBV Capsid protein P40 OS=Epstein-Barr virus (strain
B95-8) GN=BVRF2 PE=1 SV=1
Length = 605

Score = 30.4 bits (67), Expect = 6.4
Identities = 11/21 (52%), Positives = 13/21 (61%)
Frame = +1

Query: 124 YTYHAHPHPPYSLFSLASTSG 186
+TYH HPHPP + F L G
Sbjct: 367 HTYHPHPHPPPAYFGLPGLFG 387


>sp|Q8XJ01|PBPA_CLOPE Penicillin-binding protein 1A OS=Clostridium
perfringens GN=pbpA PE=3 SV=1
Length = 679

Score = 30.4 bits (67), Expect = 6.4
Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
Frame = +3

Query: 141 STSTLFSI--LFGVHKRQTNLSLFLNIISKHVDTIADLGKSAETKIYTIPSSF 293
+T TL S +FG + +TN L+ ++ H + I D ETKI++ +S+
Sbjct: 533 NTYTLASAFGVFGNNGVKTNAKLYTKVLDSHGNVILDTSTPEETKIFSPQASY 585


>sp|Q0TNZ8|PBPA_CLOP1 Penicillin-binding protein 1A OS=Clostridium
perfringens (strain ATCC 13124 / NCTC 8237 / Type A)
GN=pbpA PE=3 SV=1
Length = 830

Score = 30.4 bits (67), Expect = 6.4
Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
Frame = +3

Query: 141 STSTLFSI--LFGVHKRQTNLSLFLNIISKHVDTIADLGKSAETKIYTIPSSF 293
+T TL S +FG + +TN L+ ++ H + I D ETKI++ +S+
Sbjct: 533 NTYTLASAFGVFGNNGVKTNAKLYTKVLDSHGNVILDTSTPEETKIFSPQASY 585


>sp|A3LNC4|U507_PICST UPF0507 protein PICST_55861 OS=Pichia stipitis
GN=PICST_55861 PE=3 SV=2
Length = 1194

Score = 30.0 bits (66), Expect = 8.3
Identities = 13/64 (20%), Positives = 31/64 (48%)
Frame = -3

Query: 534 WMSNSMETRCKPAEEVMEEVEQKGSLLVRVRRIEMQLSQIIDSTNSSKCGHGVRKECVSA 355
W+ S++ K +++EE+ L +R + +L QI + + S+ G + + +
Sbjct: 1023 WLQISLDELLKSVNKILEEIRTWKELYSSIRELNSELHQIEEKSPSNNNGGSLSRRSTFS 1082

Query: 354 LEEL 343
+E +
Sbjct: 1083 IEPI 1086


>sp|P40026|KRE29_YEAST DNA repair protein KRE29 OS=Saccharomyces
cerevisiae GN=KRE29 PE=1 SV=1
Length = 464

Score = 30.0 bits (66), Expect = 8.3
Identities = 17/35 (48%), Positives = 23/35 (65%)
Frame = +3

Query: 120 FVHLPCPSTSTLFSILFGVHKRQTNLSLFLNIISK 224
FVHL CPS + L +LFGV++ + N SL +N K
Sbjct: 238 FVHLKCPSITNLL-VLFGVNQEKCN-SLKINYEKK 270


>sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans
GN=dcr-1 PE=1 SV=2
Length = 1845

Score = 30.0 bits (66), Expect = 8.3
Identities = 23/88 (26%), Positives = 37/88 (42%)
Frame = +2

Query: 95 PHYTHHSYLCTPTMPIHIHPILYSLWRPQAANKSVFVS*HYKQTCRYNCRLRQKC*DQDL 274
PH + L M IH PI +LW AA S+F R+ Q +L
Sbjct: 921 PHSSQRQILVPELMDIH--PISATLWNVIAALPSIFY------------RVNQLLLTDEL 966

Query: 275 HDTIKFQSTWRSSSKVETHSTWRSSSKA 358
+TI ++ + +K++ + W S + A
Sbjct: 967 RETILVKAFGKEKTKLDDNVEWNSLAYA 994


>sp|Q9CZH8|CCD77_MOUSE Coiled-coil domain-containing protein 77
OS=Mus musculus GN=Ccdc77 PE=2 SV=1
Length = 489

Score = 30.0 bits (66), Expect = 8.3
Identities = 18/64 (28%), Positives = 31/64 (48%)
Frame = -3

Query: 411 DSTNSSKCGHGVRKECVSALEELLHVECVSTLEELLQVD*NLMVSCKSWSQHFCLSLQLY 232
D+ K + + ++E+ L V C S +ELL+ M +C+S ++ L+LY
Sbjct: 28 DTNRWKKMADSMESTPLPSVEDRLAVLCPS--QELLEYYQKKMANCESENEDLLKKLELY 85

Query: 231 RHVC 220
R C
Sbjct: 86 REAC 89


tr_hit_id A9RKN6
Definition tr|A9RKN6|A9RKN6_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 38
Score (bit) 42.0
E-value 0.023
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913512|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_A10.
(566 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RKN6|A9RKN6_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.023
tr|Q48AK9|Q48AK9_COLP3 Putative uncharacterized protein OS=Colwe... 36 1.7
tr|Q3KJ27|Q3KJ27_PSEPF Putative uncharacterized protein OS=Pseud... 34 4.9
tr|B1H2P9|B1H2P9_XENTR Mib2 protein OS=Xenopus tropicalis GN=mib... 34 6.4
tr|Q113R7|Q113R7_TRIEI Transcriptional regulator, LysR family OS... 34 6.4
tr|Q2R1N6|Q2R1N6_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 33 8.3
tr|Q2R1N5|Q2R1N5_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 33 8.3
tr|Q2R1N4|Q2R1N4_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 33 8.3
tr|B8BLC1|B8BLC1_ORYSI Putative uncharacterized protein OS=Oryza... 33 8.3
tr|A9RSF0|A9RSF0_PHYPA Predicted protein OS=Physcomitrella paten... 33 8.3
tr|A3CCU2|A3CCU2_ORYSJ Putative uncharacterized protein OS=Oryza... 33 8.3
tr|Q4DAK9|Q4DAK9_TRYCR Putative uncharacterized protein OS=Trypa... 33 8.3
tr|Q4CP84|Q4CP84_TRYCR Putative uncharacterized protein (Fragmen... 33 8.3
tr|Q4CKH6|Q4CKH6_TRYCR Putative uncharacterized protein (Fragmen... 33 8.3

>tr|A9RKN6|A9RKN6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_159686 PE=4 SV=1
Length = 521

Score = 42.0 bits (97), Expect = 0.023
Identities = 17/38 (44%), Positives = 30/38 (78%)
Frame = -3

Query: 525 NSMETRCKPAEEVMEEVEQKGSLLVRVRRIEMQLSQII 412
+S+E RC+PA+ V+ E E KG+L+ R++R+E+++ Q I
Sbjct: 463 SSLERRCRPAKTVLLEAEAKGTLVERIQRLEIRIGQSI 500


>tr|Q48AK9|Q48AK9_COLP3 Putative uncharacterized protein
OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
GN=CPS_0136 PE=4 SV=1
Length = 719

Score = 35.8 bits (81), Expect = 1.7
Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
Frame = -3

Query: 540 RRWMSNSMETRCKPAEEVMEEVEQKGSLLVR---VRRIEMQLSQIIDSTNSSKCGHGVRK 370
RR SN + T K + ++ + E+K ++ + + ++ L ++ +T ++ GHG +
Sbjct: 465 RREFSNLVLTEDKLSIKLFKRHEKKAEKVIALADINQCQVLLGDLVIATINTTMGHGFDE 524

Query: 369 ECVSALEELLHVECVSTLEELLQVD*NLMVSCKSWSQH-FCLSLQ 238
E AL ++ H+E ++ + + NL + +S +H CL L+
Sbjct: 525 EHEQALRDIFHIEQIAKMTDGKVRRINLALHTESKKRHIICLYLR 569


>tr|Q3KJ27|Q3KJ27_PSEPF Putative uncharacterized protein
OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pf01_0485
PE=4 SV=1
Length = 322

Score = 34.3 bits (77), Expect = 4.9
Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 7/85 (8%)
Frame = +3

Query: 120 FVHLPCPSTSTLFSILFGVHKRQTNLSLFLNIISKHVD-------TIADLGKSAETKIYT 278
+VHLP S ++ + V K NLSLF HVD +A L + +Y
Sbjct: 181 YVHLPTASLQLIYDLRLDVPKEAKNLSLF------HVDERLEGDQLVARLDRK-RPDLYL 233

Query: 279 IPSSFNQPGEALPRLRHTQRGEALP 353
+P Q GE LP L ++G+ P
Sbjct: 234 MPL---QDGEPLPELYTLKKGQLYP 255


>tr|B1H2P9|B1H2P9_XENTR Mib2 protein OS=Xenopus tropicalis GN=mib2
PE=2 SV=1
Length = 951

Score = 33.9 bits (76), Expect = 6.4
Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%)
Frame = -3

Query: 540 RRWMSNSMETRCKPAEEVMEEVEQKGSLLVRVRRIEMQLSQIIDSTNSSK----CGHGVR 373
R+ +S E C P+ EV ++ + L R R++E +++ I N K CGHG
Sbjct: 867 RKLRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSC 926

Query: 372 KECVSAL 352
EC ++L
Sbjct: 927 TECSTSL 933


>tr|Q113R7|Q113R7_TRIEI Transcriptional regulator, LysR family
OS=Trichodesmium erythraeum (strain IMS101) GN=Tery_2009
PE=4 SV=1
Length = 334

Score = 33.9 bits (76), Expect = 6.4
Identities = 19/60 (31%), Positives = 37/60 (61%)
Frame = -3

Query: 492 EVMEEVEQKGSLLVRVRRIEMQLSQIIDSTNSSKCGHGVRKECVSALEELLHVECVSTLE 313
+V+++V + ++ R R+EM+LS I N+ + G GV VSA+E+ L + ++T++
Sbjct: 210 KVIDQVLSQSNIDTRRLRVEMELSSIEAIKNAVQSGLGVAFVSVSAIEKELQIGVMTTVK 269


>tr|Q2R1N6|Q2R1N6_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os11g38610 PE=4 SV=2
Length = 888

Score = 33.5 bits (75), Expect = 8.3
Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)
Frame = +3

Query: 135 CPSTSTLFSILFGVHKRQTNLSLFLNIISK-----HVDTIADLGKSAETKIY--TIPSSF 293
CP L LFG+HK T + FLN+ + ++T AD+ KS + K + T ++
Sbjct: 771 CPDHRCLSHELFGMHKNATESTYFLNVGASELRNIEMNTFADVIKSVDKKFHCNTESNAH 830

Query: 294 NQP 302
N P
Sbjct: 831 NHP 833


>tr|Q2R1N5|Q2R1N5_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=Os11g0598800 PE=2 SV=1
Length = 952

Score = 33.5 bits (75), Expect = 8.3
Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)
Frame = +3

Query: 135 CPSTSTLFSILFGVHKRQTNLSLFLNIISK-----HVDTIADLGKSAETKIY--TIPSSF 293
CP L LFG+HK T + FLN+ + ++T AD+ KS + K + T ++
Sbjct: 771 CPDHRCLSHELFGMHKNATESTYFLNVGASELRNIEMNTFADVIKSVDKKFHCNTESNAH 830

Query: 294 NQP 302
N P
Sbjct: 831 NHP 833


>tr|Q2R1N4|Q2R1N4_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os11g38610 PE=4 SV=2
Length = 967

Score = 33.5 bits (75), Expect = 8.3
Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)
Frame = +3

Query: 135 CPSTSTLFSILFGVHKRQTNLSLFLNIISK-----HVDTIADLGKSAETKIY--TIPSSF 293
CP L LFG+HK T + FLN+ + ++T AD+ KS + K + T ++
Sbjct: 771 CPDHRCLSHELFGMHKNATESTYFLNVGASELRNIEMNTFADVIKSVDKKFHCNTESNAH 830

Query: 294 NQP 302
N P
Sbjct: 831 NHP 833


>tr|B8BLC1|B8BLC1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_36682 PE=4 SV=1
Length = 745

Score = 33.5 bits (75), Expect = 8.3
Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)
Frame = +3

Query: 135 CPSTSTLFSILFGVHKRQTNLSLFLNIISK-----HVDTIADLGKSAETKIY--TIPSSF 293
CP L LFG+HK T + FLN+ + ++T AD+ KS + K + T ++
Sbjct: 574 CPDHRCLSHELFGMHKNATESTYFLNVGASELRNIEMNTFADVIKSVDKKFHCNTESNAH 633

Query: 294 NQP 302
N P
Sbjct: 634 NHP 636


>tr|A9RSF0|A9RSF0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_69948 PE=4 SV=1
Length = 172

Score = 33.5 bits (75), Expect = 8.3
Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)
Frame = -1

Query: 398 LASVDMEYAKSVSPPWKSFSTLS---VSQPWKSFSRLIET*WYRV 273
L +V E ++ SP ++T+S V QPW +S+L+E W RV
Sbjct: 37 LCAVTQEQRQTFSPRCGGYATVSLHYVGQPWSEWSQLVEFGWVRV 81