BP913514
Clone id YMU001_000031_A12
Library
Length 393
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGCGCTCCTCCTGCCCTGCCCGGACACTGGCAAGTCGATCTTCCTTCTCTCGTCGCTTG
CGTACATTGGCCTGAAAGACTCTTCAAGAATCAATTGGCTGTGCAATTCACCATTTTAAA
CTTTTCATATTTCTACTTCAACTTTCAAACCTCTAACATAGCTGGATTGACACCACGGTC
GTACATGTATTCAGAAGTTGGGATTTTGACCAACTCCTCTTTCCCTCTTGATTTTCCAAT
GCCAGCATTAGCCAAAGCATCTCGGGCAGCCTTCTTTGCCTGAAGTTTTTTGATACGCTG
AAAGTCCAAATCTGAGAGAATGCCATCACCATCTTGCCGGTTCTCTCCTGCTAACTTACT
GTCATCTTGACTTTGATTCACCAGTAACTTCTT
■■Homology search results ■■ -
sp_hit_id Q2LQK5
Definition sp|Q2LQK5|SYL_SYNAS Leucyl-tRNA synthetase OS=Syntrophus aciditrophicus (strain SB)
Align length 39
Score (bit) 28.9
E-value 8.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913514|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_A12.
(370 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2LQK5|SYL_SYNAS Leucyl-tRNA synthetase OS=Syntrophus aciditr... 29 8.3

>sp|Q2LQK5|SYL_SYNAS Leucyl-tRNA synthetase OS=Syntrophus
aciditrophicus (strain SB) GN=leuS PE=3 SV=1
Length = 862

Score = 28.9 bits (63), Expect = 8.3
Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 6/39 (15%)
Frame = -3

Query: 332 VSRREPARW*WHSLRF------GLSAYQKTSGKEGCPRC 234
VS EP + W L F GL AY+KTS CPRC
Sbjct: 125 VSTCEPVYYRWEQLFFLWMYEKGL-AYKKTSSVNWCPRC 162


tr_hit_id A9TQ79
Definition tr|A9TQ79|A9TQ79_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 81
Score (bit) 32.7
E-value 0.063
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913514|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_A12.
(370 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TQ79|A9TQ79_PHYPA Predicted protein OS=Physcomitrella paten... 33 0.063

>tr|A9TQ79|A9TQ79_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_148946 PE=4 SV=1
Length = 769

Score = 32.7 bits (73), Expect(2) = 0.063
Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 3/81 (3%)
Frame = -1

Query: 370 KKLLVNQSQDDSKLAGENRQDGDGILSDLDFQRIXXXXXXXXXXXXXXXAGIGKSRGK-- 197
KK+ ++ + + + +R DGDGILS+ DFQRI G+ K+ GK
Sbjct: 633 KKMYASKVEQKAAIEVVSR-DGDGILSNEDFQRIRELQAKRAAKAAMAEHGLSKA-GKFR 690

Query: 196 -EELVKIPTSEYMYDRGVNPA 137
E VK+ + ++ VNPA
Sbjct: 691 QEIAVKLDKHGNLNEKRVNPA 711



Score = 26.6 bits (57), Expect(2) = 0.063
Identities = 11/17 (64%), Positives = 15/17 (88%)
Frame = -2

Query: 51 QANVRKRREKEDRLASV 1
+A +RKR+EKE+R ASV
Sbjct: 714 EARIRKRQEKEERQASV 730