BP913518
Clone id YMU001_000031_B04
Library
Length 449
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ACAGCAGTTGGCGATAAAGGAGCATCAGTTGGATGAGCCCAGCTTGGGGAAAAAGATCCG
ATTAGCTCTGCTCTATTTTATCTAGCTTTGCAGTGTGGACTGATGCTTTGAAAGTTATGG
ATGGTTGAATGATGGGGAAGACTGCGGTGGCTGGGGGGTGAAGTTTTATAAAGCTGTAAC
GTCCTCTTCCTGCTTATGGACTTTGTGGTTCAATTAGGGTAGTCAGAATGGACGTTAAGT
TTTGGGCTTCTCTGGTGAGAGGTCCTATCTAGGATTTCCTTTTAGATTACTAGATTGATG
GTTGACTTGGGATGGAATTTTACTGCACTAACCAAAGTTTAGATCGGTTTAGTAGAGCCT
GACCTTTACTTCTGTACAGTCATGATCTTATGCAGCTCCATGTTGATCCTTTCTTGATGC
TCGATTCATGGATATGGATGTGTGATAGC
■■Homology search results ■■ -
sp_hit_id A6W5T0
Definition sp|A6W5T0|RPOB_KINRD DNA-directed RNA polymerase subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Align length 38
Score (bit) 29.3
E-value 8.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913518|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_B04.
(449 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A6W5T0|RPOB_KINRD DNA-directed RNA polymerase subunit beta OS... 29 8.0
sp|Q0BYP2|GCSPA_HYPNA Probable glycine dehydrogenase [decarboxyl... 29 8.0

>sp|A6W5T0|RPOB_KINRD DNA-directed RNA polymerase subunit beta
OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM
14245 / SRS30216) GN=rpoB PE=3 SV=1
Length = 1171

Score = 29.3 bits (64), Expect = 8.0
Identities = 16/38 (42%), Positives = 21/38 (55%)
Frame = -2

Query: 265 GPLTREAQNLTSILTTLIEPQSP*AGRGRYSFIKLHPP 152
GPL + ++ +T I QSP GRYSF K+H P
Sbjct: 3 GPLLAASLPASAPNSTYIGNQSPRTVSGRYSFGKIHEP 40


>sp|Q0BYP2|GCSPA_HYPNA Probable glycine dehydrogenase
[decarboxylating] subunit 1 OS=Hyphomonas neptunium
(strain ATCC 15444) GN=gcvPA PE=3 SV=1
Length = 447

Score = 29.3 bits (64), Expect = 8.0
Identities = 19/68 (27%), Positives = 30/68 (44%)
Frame = -1

Query: 422 EHQERINMELHKIMTVQK*RSGSTKPI*TLVSAVKFHPKSTINLVI*KEILDRTSHQRSP 243
+HQ + +E H K RS S+ P A K H +T++++I QRS
Sbjct: 45 DHQGELAVERHLTKLAAKNRSASSGPFFVGAGAYKHHVPATVDMII----------QRSE 94

Query: 242 KLNVHSDY 219
L ++ Y
Sbjct: 95 FLTTYTPY 102


tr_hit_id Q0CDY7
Definition tr|Q0CDY7|Q0CDY7_ASPTN Predicted protein OS=Aspergillus terreus (strain NIH 2624)
Align length 67
Score (bit) 38.1
E-value 0.22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913518|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_B04.
(449 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0CDY7|Q0CDY7_ASPTN Predicted protein OS=Aspergillus terreus ... 38 0.22

>tr|Q0CDY7|Q0CDY7_ASPTN Predicted protein OS=Aspergillus terreus
(strain NIH 2624) GN=ATEG_08097 PE=4 SV=1
Length = 1179

Score = 38.1 bits (87), Expect = 0.22
Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
Frame = -2

Query: 262 PLTREAQNLTSILTTLIEPQSP*AGRGRYSFIKLHPPATAVFPIIQPSI-TFKASVHTAK 86
PL++ A N +I P++P GR S + PAT V P++ P KA V
Sbjct: 597 PLSKSADNAVTIPVKKYIPKTPATGRATRSMSRRAEPATVVLPLVYPRFGKKKAEVDIQD 656

Query: 85 LDKIEQS 65
LD++ +S
Sbjct: 657 LDRLRES 663