BP913519
Clone id YMU001_000031_B05
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_B05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACCCAAACCAAGTCAAAACTGTAGCATCGAACTTCATTGTTGGCAAATGAGTCACTGTA
AGCAGCCATGCCAAGGGGCTGTAGCACAGAAATACTCCATCCCTTTTACTTGAAACTCAA
ATCAGCATCCTTCTCTTCATGGGGCGCTTGCTCCTAGCACTTGCATCATCATCATTGTCA
GCTTGCCCTTCACTGTCATCCTCACCAGCCCCCAGCTCAATTGTTAATTCGCATGGTTCA
GATGAAGTGCGACCTCTATTTCGAGAATTTTTCCTAATGGGAGTAGAAGGGGCCTGAGAA
GCCATAGCCTGCTGACTCCTCTTGGGCATAAGCTCTGCCCCTTGTACCACCATCTCCTTC
ATCAAAATCCAGTCTTTGAAGTCAAATCTAAAGACAAATTGAGTATTCACAACTTGTTGC
TGTTCTTCAACTCCCTGAGGCCTCCCTGCCCTTTCAGCAGCAGTAGGAGCATACCTGAAT
GCCACAAACTGCTTTCCATCCTGTATTGTAATTTGGGCACGACCATCTTTCACCAAAAAT
GAGAGAGAGA
■■Homology search results ■■ -
sp_hit_id Q566X8
Definition sp|Q566X8|DMX1B_DANRE Diencephalon/mesencephalon homeobox protein 1-B OS=Danio rerio
Align length 75
Score (bit) 37.0
E-value 0.063
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913519|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_B05.
(550 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q566X8|DMX1B_DANRE Diencephalon/mesencephalon homeobox protei... 37 0.063
sp|Q54XM9|TAF11_DICDI Transcription initiation factor TFIID subu... 31 3.4
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostr... 31 3.4
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostr... 31 3.4
sp|A6SMQ7|CHZ1_BOTFB Histone H2A.Z-specific chaperone chz1 OS=Bo... 31 4.5
sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2 OS=Clostr... 30 5.9
sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes prote... 30 7.7
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago... 30 7.7

>sp|Q566X8|DMX1B_DANRE Diencephalon/mesencephalon homeobox protein
1-B OS=Danio rerio GN=dmbx1b PE=2 SV=1
Length = 369

Score = 37.0 bits (84), Expect = 0.063
Identities = 21/75 (28%), Positives = 34/75 (45%)
Frame = -3

Query: 362 MKEMVVQGAELMPKRSQQAMASQAPSTPIRKNSRNRGRTSSEPCELTIELGAGEDDSEGQ 183
+KE +GA+ K + +QAP +P+ RG TS+ CEL E+ + G
Sbjct: 136 LKEAGTEGAQDEGKEEAPPVEAQAPPSPL----DGRGLTSAPSCELNEEVNVTSPEQSGA 191

Query: 182 ADNDDDASARSKRPM 138
+D + R P+
Sbjct: 192 ESGAEDTTDREDEPL 206


>sp|Q54XM9|TAF11_DICDI Transcription initiation factor TFIID subunit
11 OS=Dictyostelium discoideum GN=taf11 PE=3 SV=1
Length = 450

Score = 31.2 bits (69), Expect = 3.4
Identities = 16/61 (26%), Positives = 29/61 (47%)
Frame = -3

Query: 326 PKRSQQAMASQAPSTPIRKNSRNRGRTSSEPCELTIELGAGEDDSEGQADNDDDASARSK 147
P +S + PST +TS + + + A DD E + D+DDD ++++K
Sbjct: 159 PSQSTKKQRISTPSTASANKKPTVNKTSKKIEQSEDDESADNDDDEDEDDDDDDNNSKNK 218

Query: 146 R 144
+
Sbjct: 219 K 219


>sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2
OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC
13319 / Type A) GN=infB PE=3 SV=1
Length = 688

Score = 31.2 bits (69), Expect = 3.4
Identities = 17/47 (36%), Positives = 25/47 (53%)
Frame = -3

Query: 239 EPCELTIELGAGEDDSEGQADNDDDASARSKRPMKRRMLI*VSSKRD 99
E L EL +G++ SE + DD+ +K P+K M S+KRD
Sbjct: 42 EDANLIKELLSGKEKSEKTKEEDDEIETTAKNPIKESMNNKKSNKRD 88


>sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2
OS=Clostridium botulinum (strain ATCC 19397 / Type A)
GN=infB PE=3 SV=1
Length = 688

Score = 31.2 bits (69), Expect = 3.4
Identities = 17/47 (36%), Positives = 25/47 (53%)
Frame = -3

Query: 239 EPCELTIELGAGEDDSEGQADNDDDASARSKRPMKRRMLI*VSSKRD 99
E L EL +G++ SE + DD+ +K P+K M S+KRD
Sbjct: 42 EDANLIKELLSGKEKSEKTKEEDDEIETTAKNPIKESMNNKKSNKRD 88


>sp|A6SMQ7|CHZ1_BOTFB Histone H2A.Z-specific chaperone chz1
OS=Botryotinia fuckeliana (strain B05.10) GN=chz1 PE=3
SV=1
Length = 111

Score = 30.8 bits (68), Expect = 4.5
Identities = 13/34 (38%), Positives = 24/34 (70%)
Frame = -3

Query: 263 RNRGRTSSEPCELTIELGAGEDDSEGQADNDDDA 162
+ +G++++EP ++T +G G DDS + + DDDA
Sbjct: 14 KGKGKSAAEPQDVT--MGEGGDDSSSEEEVDDDA 45


>sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2
OS=Clostridium botulinum (strain Langeland / NCTC 10281
/ Type F) GN=infB PE=3 SV=1
Length = 688

Score = 30.4 bits (67), Expect = 5.9
Identities = 16/47 (34%), Positives = 26/47 (55%)
Frame = -3

Query: 239 EPCELTIELGAGEDDSEGQADNDDDASARSKRPMKRRMLI*VSSKRD 99
E +L EL +G++ SE + DD+ +K P+K + S+KRD
Sbjct: 42 EDADLIKELLSGKEKSEKTKEEDDEIETTAKNPIKESINNKKSNKRD 88


>sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein
6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1
Length = 1185

Score = 30.0 bits (66), Expect = 7.7
Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 14/114 (12%)
Frame = -3

Query: 428 EEQQQVVNTQFVFRFDFKDWILMKEMVVQGAELMPKRSQQAMASQAPST-----PIRKNS 264
EE+++ + + + +D ++ V G ++ P + Q Q P + ++ S
Sbjct: 20 EEEEEDDDDELIHSTQDQDRPHKQQRVENGKQMTPTKQHQQQQQQQPISNGRLKKLKAQS 79

Query: 263 RNRGRTSSEPCELTIEL---------GAGEDDSEGQADNDDDASARSKRPMKRR 129
+ SSE + +E + +DD + D+DDD ++ +R RR
Sbjct: 80 SDEESGSSEDDDEDVEDVDSSGSDSGSSDDDDDDDDDDDDDDGNSEDEREAVRR 133


>sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago
maydis GN=DBP4 PE=3 SV=1
Length = 869

Score = 30.0 bits (66), Expect = 7.7
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -3

Query: 230 ELTIELGAGEDDSEGQADNDDDASARSKRPMKRRM 126
+LT E +DD D+DDD + R+ P +R+M
Sbjct: 802 DLTTEEDEDDDDDADDDDDDDDEAYRAPAPKRRKM 836


tr_hit_id A9TPF3
Definition tr|A9TPF3|A9TPF3_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 143
Score (bit) 89.4
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913519|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_B05.
(550 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TPF3|A9TPF3_PHYPA Predicted protein (Fragment) OS=Physcomit... 89 1e-16
tr|B6TF46|B6TF46_MAIZE Putative uncharacterized protein OS=Zea m... 85 2e-15
tr|B4FSE7|B4FSE7_MAIZE Putative uncharacterized protein OS=Zea m... 85 2e-15
tr|B4FDX3|B4FDX3_MAIZE Putative uncharacterized protein OS=Zea m... 85 2e-15
tr|A7PVV4|A7PVV4_VITVI Chromosome chr8 scaffold_34, whole genome... 79 2e-13
tr|A7NZZ7|A7NZZ7_VITVI Chromosome chr6 scaffold_3, whole genome ... 77 5e-13
tr|Q9C689|Q9C689_ARATH Putative uncharacterized protein F23H24.4... 76 1e-12
tr|B8AJA9|B8AJA9_ORYSI Putative uncharacterized protein OS=Oryza... 74 7e-12
tr|Q69XQ4|Q69XQ4_ORYSJ Os06g0618000 protein OS=Oryza sativa subs... 69 2e-10
tr|B8B4M1|B8B4M1_ORYSI Putative uncharacterized protein OS=Oryza... 69 2e-10
tr|Q7EXY7|Q7EXY7_ORYSJ Os08g0510900 protein OS=Oryza sativa subs... 67 8e-10
tr|B8BCB8|B8BCB8_ORYSI Putative uncharacterized protein OS=Oryza... 67 8e-10
tr|B6V8G0|B6V8G0_HELAN COG5125-like protein OS=Helianthus annuus... 67 8e-10
tr|A3BUR1|A3BUR1_ORYSJ Putative uncharacterized protein OS=Oryza... 67 8e-10
tr|Q9LT44|Q9LT44_ARATH Arabidopsis thaliana genomic DNA, chromos... 64 7e-09
tr|A3A434|A3A434_ORYSJ Putative uncharacterized protein OS=Oryza... 62 2e-08
tr|Q6K3M6|Q6K3M6_ORYSJ Putative uncharacterized protein OSJNBb00... 56 1e-06
tr|A8J9Q8|A8J9Q8_CHLRE Predicted protein OS=Chlamydomonas reinha... 40 0.080
tr|B8B6H7|B8B6H7_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.52
tr|A7SJ31|A7SJ31_NEMVE Predicted protein (Fragment) OS=Nematoste... 37 0.89
tr|A2ET83|A2ET83_TRIVA F/Y-rich N-terminus family protein OS=Tri... 36 1.5
tr|Q7XNP4|Q7XNP4_ORYSJ OSJNBa0045O17.1 protein (Putative unchara... 35 3.4
tr|Q69LA7|Q69LA7_ORYSJ Putative uncharacterized protein B1026C12... 35 3.4
tr|A3BFP3|A3BFP3_ORYSJ Putative uncharacterized protein OS=Oryza... 35 3.4
tr|B4PWL7|B4PWL7_DROYA GE16055 OS=Drosophila yakuba GN=GE16055 P... 35 3.4
tr|A7RIG0|A7RIG0_NEMVE Predicted protein OS=Nematostella vectens... 35 3.4
tr|Q7QIA2|Q7QIA2_ANOGA AGAP006745-PB OS=Anopheles gambiae GN=AGA... 34 4.4
tr|Q22GD4|Q22GD4_TETTH Putative uncharacterized protein OS=Tetra... 34 4.4
tr|Q2GVM0|Q2GVM0_CHAGB Putative uncharacterized protein OS=Chaet... 34 4.4
tr|A8NEY7|A8NEY7_COPC7 Putative uncharacterized protein OS=Copri... 34 4.4

>tr|A9TPF3|A9TPF3_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_148594 PE=4 SV=1
Length = 321

Score = 89.4 bits (220), Expect = 1e-16
Identities = 61/143 (42%), Positives = 79/143 (55%), Gaps = 4/143 (2%)
Frame = -3

Query: 548 SLSFLVKDGRAQITI-QDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
SLSFL+KDGRA IT +DG VA + AP++ +R + QV NTQFVFR+D+
Sbjct: 196 SLSFLIKDGRAAITYDKDGTHLVAPKNAPSSHDR--------QSGQVTNTQFVFRYDWTC 247

Query: 371 WILMKEMVVQGAELMPKRSQ--QAMASQAPSTPIRKNSRNRGRTSSEPCELTIELGAGED 198
W M+E + GAELMP R + + STPIRK+SRNRGR S A
Sbjct: 248 WQTMQEKLEAGAELMPDRQSTLDPLLQPSQSTPIRKHSRNRGRESR---------NANNP 298

Query: 197 DSEGQADNDDDASAR-SKRPMKR 132
+++G +DA R SKR R
Sbjct: 299 ENDGDDVEPEDAGQRHSKRARGR 321


>tr|B6TF46|B6TF46_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 352

Score = 85.1 bits (209), Expect = 2e-15
Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKDW 369
+LSFLVKDGR +IT+ D V R AP A+ A +V + FVFRFDFKDW
Sbjct: 223 ALSFLVKDGRVEITVDDSGHIVRPRNAPAASAIASG--------EVSYSHFVFRFDFKDW 274

Query: 368 ILMKEMVVQGAELMPKRSQQA-----------MASQAPSTPIRKNSRNRG 252
LMKE+V +G EL+P R+ Q+ + ++A TPIRK +RNRG
Sbjct: 275 KLMKEVVTEGEELLPHRTSQSNLCNEENDQPNLEARAQITPIRKLTRNRG 324


>tr|B4FSE7|B4FSE7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 352

Score = 85.1 bits (209), Expect = 2e-15
Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKDW 369
+LSFLVKDGR +IT+ D V R AP A+ A +V + FVFRFDFKDW
Sbjct: 223 ALSFLVKDGRVEITVDDSGHIVRPRNAPAASAIASG--------EVSYSHFVFRFDFKDW 274

Query: 368 ILMKEMVVQGAELMPKRSQQA-----------MASQAPSTPIRKNSRNRG 252
LMKE+V +G EL+P R+ Q+ + ++A TPIRK +RNRG
Sbjct: 275 KLMKEVVTEGEELLPHRTSQSNLCNEENDQPNLEARAQITPIRKLTRNRG 324


>tr|B4FDX3|B4FDX3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 396

Score = 85.1 bits (209), Expect = 2e-15
Identities = 59/140 (42%), Positives = 69/140 (49%), Gaps = 14/140 (10%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQD-GKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFLVKDGR +I + D G FV R AP A+ A VV FVFRFDFKD
Sbjct: 234 ALSFLVKDGRVEIKVNDQGHHFVYPRNAPVASAVASG--------DVVYNHFVFRFDFKD 285

Query: 371 WILMKEMVVQGAELMPKRSQQAMAS-------------QAPSTPIRKNSRNRGRTSSEPC 231
W LMK +V +G ELMP RS Q +A+ PST IRK RNRG +
Sbjct: 286 WKLMKGVVPEGEELMPHRSSQTIANTGGNNPTQSEAPLATPSTTIRKLCRNRGLILQDEL 345

Query: 230 ELTIELGAGEDDSEGQADND 171
T G E + ND
Sbjct: 346 IATGAYGVMEQEMLAMGTND 365


>tr|A7PVV4|A7PVV4_VITVI Chromosome chr8 scaffold_34, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025372001
PE=4 SV=1
Length = 380

Score = 79.0 bits (193), Expect = 2e-13
Identities = 56/138 (40%), Positives = 71/138 (51%), Gaps = 15/138 (10%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQD-GKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFLVKDGRA+IT+ G V+ R AP A +V FVFRFDFKD
Sbjct: 240 ALSFLVKDGRAEITVDGRGCHLVSPRNAPAA--------NAVVSGEVCYNHFVFRFDFKD 291

Query: 371 WILMKEMVVQGAELMPKR--------------SQQAMASQAPSTPIRKNSRNRGRTSSEP 234
W LM V G ELMP+R +++ A+ AP+TPIRK SRNRG E
Sbjct: 292 WKLMATSVGAGEELMPQRNSVNLPNNSQTDSVAEECEAAAAPTTPIRKLSRNRGLVLQE- 350

Query: 233 CELTIELGAGEDDSEGQA 180
+ +E DD+ +A
Sbjct: 351 -QAVVEDSPESDDAGTRA 367


>tr|A7NZZ7|A7NZZ7_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024708001
PE=4 SV=1
Length = 377

Score = 77.4 bits (189), Expect = 5e-13
Identities = 60/151 (39%), Positives = 78/151 (51%), Gaps = 14/151 (9%)
Frame = -3

Query: 548 SLSFLVKDGRAQITI-QDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFLVKDGRA++ + ++G V+ + AP A+ R +VV + FVFRFDFKD
Sbjct: 241 ALSFLVKDGRAEVVVDENGSHLVSPKNAPAASSVVAR--------EVVYSHFVFRFDFKD 292

Query: 371 WILMKEMVVQGAELMP--KRSQQAMASQA-----------PSTPIRKNSRNRGRTSSEPC 231
W LM ++V G ELMP RS+ ASQA +TPI+K SRN G E
Sbjct: 293 WKLMMDLVPAGEELMPHRDRSKGLNASQAGLAPNDYQDTLHATPIKKFSRNCGLVIQE-- 350

Query: 230 ELTIELGAGEDDSEGQADNDDDASARSKRPM 138
+L ED D D A R KR +
Sbjct: 351 ----QLVVKED-----PDTGDAAGRRCKRKL 372


>tr|Q9C689|Q9C689_ARATH Putative uncharacterized protein F23H24.4
(Putative uncharacterized protein At1g51130)
OS=Arabidopsis thaliana GN=At1g51130 PE=2 SV=1
Length = 403

Score = 76.3 bits (186), Expect = 1e-12
Identities = 58/157 (36%), Positives = 70/157 (44%), Gaps = 16/157 (10%)
Frame = -3

Query: 548 SLSFLVKDGRAQITI-QDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFL KDGR +I + + G F R AP A V +V+ FVFR DFKD
Sbjct: 266 ALSFLAKDGRVEIIVDKSGSHFAMPRNAPDA--------NVVMSGEVIYNHFVFRLDFKD 317

Query: 371 WILMKEMVVQGAELMPKRSQQAMASQAP---------------STPIRKNSRNRGRTSSE 237
W LM EMV G ELMP R +S P +TPIRK SRNRG E
Sbjct: 318 WKLMSEMVPLGEELMPHRQTAVASSSCPAASAPASADFTQDTQTTPIRKLSRNRGLVVQE 377

Query: 236 PCELTIELGAGEDDSEGQADNDDDASARSKRPMKRRM 126
E +E D D ++R KRR+
Sbjct: 378 --ETVVE------------DTPDKEGDGTRRRCKRRL 400


>tr|B8AJA9|B8AJA9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06217 PE=4 SV=1
Length = 360

Score = 73.6 bits (179), Expect = 7e-12
Identities = 48/112 (42%), Positives = 60/112 (53%), Gaps = 13/112 (11%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQDGKQFVAF-RYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFLVKDGR I I D + + R AP A+ A +V + FVFRFDFKD
Sbjct: 225 ALSFLVKDGRVAINIDDNGHHIVYPRNAPAASAIASG--------EVSYSHFVFRFDFKD 276

Query: 371 WILMKEMVVQGAELMPKRSQQAMASQ------------APSTPIRKNSRNRG 252
W LM+E+V G ELMP R+ + + A TPIRK +RNRG
Sbjct: 277 WKLMQEVVPDGEELMPHRNPENIPCAEDHDQADPPELCAQRTPIRKLTRNRG 328


>tr|Q69XQ4|Q69XQ4_ORYSJ Os06g0618000 protein OS=Oryza sativa subsp.
japonica GN=P0012B02.6 PE=2 SV=1
Length = 399

Score = 68.6 bits (166), Expect = 2e-10
Identities = 49/127 (38%), Positives = 60/127 (47%), Gaps = 28/127 (22%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQDGKQFVAF-RYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFLVKDGR +I++ D + + R AP A+ +VV FVFRFDFKD
Sbjct: 235 ALSFLVKDGRVEISVNDEDHHLVYPRNAPAASAITSG--------KVVYNHFVFRFDFKD 286

Query: 371 WILMKEMVVQGAELMPKR---------------------------SQQAMASQAPSTPIR 273
W LMK+MVV G ELM R + A+ A ST IR
Sbjct: 287 WKLMKDMVVDGEELMQHRPPAPQVGTHGSSTTTTTTTTGGANEGPETETPAAPAHSTAIR 346

Query: 272 KNSRNRG 252
K RNRG
Sbjct: 347 KLCRNRG 353


>tr|B8B4M1|B8B4M1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23710 PE=4 SV=1
Length = 401

Score = 68.6 bits (166), Expect = 2e-10
Identities = 49/127 (38%), Positives = 60/127 (47%), Gaps = 28/127 (22%)
Frame = -3

Query: 548 SLSFLVKDGRAQITIQDGKQFVAF-RYAPTAAERAGRPQGVEEQQQVVNTQFVFRFDFKD 372
+LSFLVKDGR +I++ D + + R AP A+ +VV FVFRFDFKD
Sbjct: 237 ALSFLVKDGRVEISVNDEDHHLVYPRNAPAASAITSG--------KVVYNHFVFRFDFKD 288

Query: 371 WILMKEMVVQGAELMPKR---------------------------SQQAMASQAPSTPIR 273
W LMK+MVV G ELM R + A+ A ST IR
Sbjct: 289 WKLMKDMVVDGEELMQHRPPAPQVGTHGSSTTTTTTTTGGANEGPETETPAAPAHSTAIR 348

Query: 272 KNSRNRG 252
K RNRG
Sbjct: 349 KLCRNRG 355