BP913522
Clone id YMU001_000031_B09
Library
Length 341
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_B09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGCATTATCCCCAGCTTTCATCACAAAGAAGTCGATCAGGCACTCTATGCCCATCACTTG
CACTCTCACATCCGAGGCCACTCCCAAACACCTAGCTTTAGCATGGTTAGCCATCCTCAT
GCGCACATTCGACTTGGATACCGCCTTGACCCCTGTTCCTTCATCGTACTTTGTCATGAC
GCAAACCTGTGCTTCGCCATCAATATAGGCTTGAACCTGCATCCTTTTCTCGATGATAGC
ATCCATCAAAGGAAGAACATCTGTCGGGCTACCTACCCTGAGTGCCATATTTTGAACCGC
GTGCAAATTGCCTTTACCCCTTGGTAGCCTAGTGCTAACAC
■■Homology search results ■■ -
sp_hit_id Q6ZRP5
Definition sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204 OS=Homo sapiens
Align length 24
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913522|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_B09.
(341 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204 ... 31 1.7
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus G... 30 2.9
sp|Q91994|OTX1_DANRE Homeobox protein OTX1 OS=Danio rerio GN=otx... 30 4.9
sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic O... 30 4.9
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC3... 29 6.4
sp|Q473Q8|UREE_RALEJ Urease accessory protein ureE OS=Ralstonia ... 29 6.4
sp|Q5RFD5|S39A7_PONAB Zinc transporter SLC39A7 OS=Pongo abelii G... 29 6.4
sp|Q8HY34|HBA_MONDO Hemoglobin subunit alpha OS=Monodelphis dome... 29 6.4
sp|P56886|F16PA_SINMW Fructose-1,6-bisphosphatase class 1 OS=Sin... 29 6.4
sp|Q91ZR5|CTSR1_MOUSE Cation channel sperm-associated protein 1 ... 29 6.4
sp|P20482|CNC_DROME Segmentation protein cap'n'collar OS=Drosoph... 29 6.4
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN... 29 8.3
sp|P23757|POXM_DROME Paired box pox-meso protein OS=Drosophila m... 29 8.3
sp|P07548|DFD_DROME Homeotic protein deformed OS=Drosophila mela... 29 8.3
sp|Q8K1L0|CREB5_MOUSE cAMP-responsive element-binding protein 5 ... 29 8.3

>sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204
OS=Homo sapiens PE=2 SV=2
Length = 223

Score = 31.2 bits (69), Expect = 1.7
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = +1

Query: 55 HLHSHIRGHSQTPSFSMVSHPHAH 126
H H+H GH+ T + S +H HAH
Sbjct: 120 HTHAHTHGHTHTRAHSTHAHTHAH 143


>sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus
GN=Slc39a7 PE=1 SV=2
Length = 476

Score = 30.4 bits (67), Expect = 2.9
Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%)
Frame = +1

Query: 16 FHHKE--VDQALYAHHLHSHIRGHSQTPSFSMVSHPHAH 126
FHH ++++ H HSH GHS+ SH H+H
Sbjct: 67 FHHGHGHTHESIWHGHAHSHDHGHSREELHHGHSHGHSH 105


>sp|Q91994|OTX1_DANRE Homeobox protein OTX1 OS=Danio rerio GN=otx1
PE=2 SV=1
Length = 323

Score = 29.6 bits (65), Expect = 4.9
Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
Frame = +1

Query: 31 VDQALYAHHLHSHIRGHSQTP--SFSMVSHPHAHI 129
VD Y +HSH H +P + SM +HPH HI
Sbjct: 228 VDCGSYLAPMHSHHHPHQLSPMTASSMPTHPHHHI 262


>sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic
OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=2
Length = 389

Score = 29.6 bits (65), Expect = 4.9
Identities = 12/26 (46%), Positives = 13/26 (50%)
Frame = +1

Query: 49 AHHLHSHIRGHSQTPSFSMVSHPHAH 126
AHH HSH GH S + HAH
Sbjct: 183 AHHRHSHPPGHDSCEGHSKIDIGHAH 208


>sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5
PE=2 SV=1
Length = 770

Score = 29.3 bits (64), Expect = 6.4
Identities = 11/31 (35%), Positives = 18/31 (58%)
Frame = +1

Query: 46 YAHHLHSHIRGHSQTPSFSMVSHPHAHIRLG 138
+++H HSH GH + + SH H+H+ G
Sbjct: 557 HSYHGHSHSHGHGHSHNDHGHSHGHSHVSSG 587


>sp|Q473Q8|UREE_RALEJ Urease accessory protein ureE OS=Ralstonia
eutropha (strain JMP134) GN=ureE PE=3 SV=1
Length = 221

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/27 (48%), Positives = 16/27 (59%)
Frame = +1

Query: 46 YAHHLHSHIRGHSQTPSFSMVSHPHAH 126
+ HH H H GHS + S S SH H+H
Sbjct: 169 HEHHGHDHDHGHSHSHSHSH-SHSHSH 194


>sp|Q5RFD5|S39A7_PONAB Zinc transporter SLC39A7 OS=Pongo abelii
GN=SLC39A7 PE=2 SV=1
Length = 469

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/41 (31%), Positives = 19/41 (46%)
Frame = +1

Query: 22 HKEVDQALYAHHLHSHIRGHSQTPSFSMVSHPHAHIRLGYR 144
H ++++ H H H GHS SH H+H L +R
Sbjct: 64 HGHTHESIWHGHTHGHDHGHSHGDLHHGHSHGHSHESLYHR 104



Score = 28.9 bits (63), Expect = 8.3
Identities = 11/25 (44%), Positives = 11/25 (44%)
Frame = +1

Query: 52 HHLHSHIRGHSQTPSFSMVSHPHAH 126
HH HSH GH T H H H
Sbjct: 55 HHGHSHAHGHGHTHESIWHGHTHGH 79


>sp|Q8HY34|HBA_MONDO Hemoglobin subunit alpha OS=Monodelphis
domestica GN=HBA PE=2 SV=3
Length = 142

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/50 (30%), Positives = 27/50 (54%)
Frame = +1

Query: 94 SFSMVSHPHAHIRLGYRLDPCSFIVLCHDANLCFAINIGLNLHPFLDDSI 243
+ S +S HAH ++DP +F LCH+ + A ++G + P + S+
Sbjct: 80 ALSALSDLHAH---NLKVDPVNFKFLCHNVLVTLASHLGKDFTPEIHASL 126


>sp|P56886|F16PA_SINMW Fructose-1,6-bisphosphatase class 1
OS=Sinorhizobium medicae (strain WSM419) GN=fbp PE=3
SV=2
Length = 349

Score = 29.3 bits (64), Expect = 6.4
Identities = 18/54 (33%), Positives = 29/54 (53%)
Frame = +1

Query: 91 PSFSMVSHPHAHIRLGYRLDPCSFIVLCHDANLCFAINIGLNLHPFLDDSIHQR 252
P+ S + H IRL Y +P +FIV + +++ L+L P +S+HQR
Sbjct: 260 PADSRKGYSHGRIRLVYEANPIAFIVENAGGSATTSVDRILDLVP---ESLHQR 310


>sp|Q91ZR5|CTSR1_MOUSE Cation channel sperm-associated protein 1
OS=Mus musculus GN=Catsper1 PE=1 SV=1
Length = 686

Score = 29.3 bits (64), Expect = 6.4
Identities = 14/32 (43%), Positives = 20/32 (62%)
Frame = +1

Query: 19 HHKEVDQALYAHHLHSHIRGHSQTPSFSMVSH 114
HHKE + + H+H HI H ++PS S +SH
Sbjct: 224 HHKE-QRHYHGDHMHHHI--HHRSPSASQLSH 252


tr_hit_id B4L8E7
Definition tr|B4L8E7|B4L8E7_DROMO GI14398 OS=Drosophila mojavensis
Align length 36
Score (bit) 36.2
E-value 0.84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913522|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_B09.
(341 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4L8E7|B4L8E7_DROMO GI14398 OS=Drosophila mojavensis GN=GI143... 36 0.84
tr|Q9W2X8|Q9W2X8_DROME CG15311 OS=Drosophila melanogaster GN=CG1... 36 1.1
tr|B4NTR0|B4NTR0_DROSI GD24696 OS=Drosophila simulans GN=GD24696... 36 1.1
tr|Q97RY8|Q97RY8_STRPN Putative uncharacterized protein OS=Strep... 35 1.9
tr|B1IAI0|B1IAI0_STRPI Putative uncharacterized protein OS=Strep... 35 1.9
tr|A5MKL2|A5MKL2_STRPN Putative uncharacterized protein OS=Strep... 35 1.9
tr|A5LRM6|A5LRM6_STRPN Putative uncharacterized protein OS=Strep... 35 1.9
tr|A5LAJ3|A5LAJ3_STRPN Putative uncharacterized protein OS=Strep... 35 1.9
tr|B2IMV3|B2IMV3_STRPS Putative uncharacterized protein OS=Strep... 34 3.2
tr|B8ZMM6|B8ZMM6_STRPN Putative uncharacterized protein OS=Strep... 34 3.2
tr|A7Q5S9|A7Q5S9_VITVI Chromosome chr14 scaffold_54, whole genom... 34 3.2
tr|Q9WHJ4|Q9WHJ4_9RETR Putative uncharacterized protein OS=Walle... 34 4.2
tr|B5L809|B5L809_CYPCA Metal transcription factor 1.1 (Fragment)... 33 5.5
tr|A9NJH5|A9NJH5_CYPCA Metal transcription factor 1 isoform a (F... 33 5.5
tr|A9NJH4|A9NJH4_CYPCA Metal transcription factor 1 (Fragment) O... 33 5.5
tr|A9NJH3|A9NJH3_CYPCA Metal transcription factor 1 (Fragment) O... 33 5.5
tr|A5MVQ6|A5MVQ6_STRPN 50S ribosomal protein L1 OS=Streptococcus... 33 5.5
tr|A5LM58|A5LM58_STRPN Putative uncharacterized protein OS=Strep... 33 5.5
tr|A4HV61|A4HV61_LEIIN Ubiquitin carboxyl-terminal hydrolase OS=... 33 5.5
tr|Q29LR0|Q29LR0_DROPS GA12158 OS=Drosophila pseudoobscura pseud... 33 7.1
tr|B0WLN1|B0WLN1_CULQU Transcription factor GATA-4 OS=Culex quin... 33 7.1
tr|B5E2N3|B5E2N3_STRP4 Putative uncharacterized protein OS=Strep... 33 9.3
tr|B4M9K2|B4M9K2_DROVI GJ17899 OS=Drosophila virilis GN=GJ17899 ... 33 9.3
tr|B3MSA6|B3MSA6_DROAN GF20833 OS=Drosophila ananassae GN=GF2083... 33 9.3

>tr|B4L8E7|B4L8E7_DROMO GI14398 OS=Drosophila mojavensis GN=GI14398
PE=4 SV=1
Length = 752

Score = 36.2 bits (82), Expect = 0.84
Identities = 15/36 (41%), Positives = 20/36 (55%)
Frame = +1

Query: 46 YAHHLHSHIRGHSQTPSFSMVSHPHAHIRLGYRLDP 153
+AHH HSH HS + S S +H H H++ L P
Sbjct: 438 HAHHTHSHSHSHSHSHSHSHAAHHHHHLQHQVALPP 473


>tr|Q9W2X8|Q9W2X8_DROME CG15311 OS=Drosophila melanogaster
GN=CG15311 PE=2 SV=1
Length = 1161

Score = 35.8 bits (81), Expect = 1.1
Identities = 15/41 (36%), Positives = 22/41 (53%)
Frame = +1

Query: 19 HHKEVDQALYAHHLHSHIRGHSQTPSFSMVSHPHAHIRLGY 141
HH Q L HH HSH G++ + + H H+H +LG+
Sbjct: 715 HHHHSGQHLGNHHHHSHHHGYNHNGAHNHHHHSHSHQKLGH 755


>tr|B4NTR0|B4NTR0_DROSI GD24696 OS=Drosophila simulans GN=GD24696
PE=4 SV=1
Length = 625

Score = 35.8 bits (81), Expect = 1.1
Identities = 15/41 (36%), Positives = 22/41 (53%)
Frame = +1

Query: 19 HHKEVDQALYAHHLHSHIRGHSQTPSFSMVSHPHAHIRLGY 141
HH Q L HH HSH G++ + + H H+H +LG+
Sbjct: 180 HHHHSGQHLGNHHHHSHHHGYNHNGAHNHHHHSHSHQKLGH 220


>tr|Q97RY8|Q97RY8_STRPN Putative uncharacterized protein
OS=Streptococcus pneumoniae GN=SP_0639 PE=4 SV=1
Length = 93

Score = 35.0 bits (79), Expect = 1.9
Identities = 21/60 (35%), Positives = 31/60 (51%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEGTGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIECLI 34
QAYI+G + V T Y E + VS S + A+ CLGV ++V+ +G CL+
Sbjct: 36 QAYIEGTTTLQVWTAYQESDLTRFVSLS---YSSEDCAEIDCLGVKKLIKVEKLGANCLL 92


>tr|B1IAI0|B1IAI0_STRPI Putative uncharacterized protein
OS=Streptococcus pneumoniae (strain Hungary19A-6)
GN=SPH_0730 PE=4 SV=1
Length = 92

Score = 35.0 bits (79), Expect = 1.9
Identities = 21/60 (35%), Positives = 31/60 (51%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEGTGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIECLI 34
QAYI+G + V T Y E + VS S + A+ CLGV ++V+ +G CL+
Sbjct: 35 QAYIEGTTTLQVWTAYQESDLTRFVSLS---YSSEDCAEIDCLGVKKLIKVEKLGANCLL 91


>tr|A5MKL2|A5MKL2_STRPN Putative uncharacterized protein
OS=Streptococcus pneumoniae SP19-BS75
GN=CGSSp19BS75_05277 PE=4 SV=1
Length = 92

Score = 35.0 bits (79), Expect = 1.9
Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEG--TGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIEC 40
QAYI+G + V T Y E TG ++S S+ + A+ CLGV ++V+ +G C
Sbjct: 35 QAYIEGTTTLQVWTAYQESDLTGFVSLSYSS-----EDCAEIDCLGVKKLIKVEKLGANC 89

Query: 39 LI 34
L+
Sbjct: 90 LL 91


>tr|A5LRM6|A5LRM6_STRPN Putative uncharacterized protein
OS=Streptococcus pneumoniae SP9-BS68 GN=CGSSp9BS68_06145
PE=4 SV=1
Length = 92

Score = 35.0 bits (79), Expect = 1.9
Identities = 21/60 (35%), Positives = 31/60 (51%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEGTGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIECLI 34
QAYI+G + V T Y E + VS S + A+ CLGV ++V+ +G CL+
Sbjct: 35 QAYIEGTTTLQVWTAYQESDLTRFVSLS---YSSEDCAEIDCLGVKKLIKVEKLGANCLL 91


>tr|A5LAJ3|A5LAJ3_STRPN Putative uncharacterized protein
OS=Streptococcus pneumoniae SP3-BS71 GN=CGSSp3BS71_07799
PE=4 SV=1
Length = 92

Score = 35.0 bits (79), Expect = 1.9
Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEG--TGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIEC 40
QAYI+G + V T Y E TG ++S S+ + A+ CLGV ++V+ +G C
Sbjct: 35 QAYIEGTTTLQVWTAYQESDLTGFVSLSYSS-----EDCAEIDCLGVKKLIKVEKLGANC 89

Query: 39 LI 34
L+
Sbjct: 90 LL 91


>tr|B2IMV3|B2IMV3_STRPS Putative uncharacterized protein
OS=Streptococcus pneumoniae (strain CGSP14) GN=SPCG_0597
PE=4 SV=1
Length = 72

Score = 34.3 bits (77), Expect = 3.2
Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEG--TGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIEC 40
QAYI+G + V T Y E TG +S S+ + A+ CLGV ++V+ +G C
Sbjct: 15 QAYIEGTTTLQVWTAYQESDLTGFVRLSYSS-----EDCAEIDCLGVKKLIKVEKLGANC 69

Query: 39 LI 34
L+
Sbjct: 70 LL 71


>tr|B8ZMM6|B8ZMM6_STRPN Putative uncharacterized protein
OS=Streptococcus pneumoniae ATCC 700669 GN=SPN23F05770
PE=4 SV=1
Length = 72

Score = 34.3 bits (77), Expect = 3.2
Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Frame = -3

Query: 213 QAYIDGEAQVCVMTKYDEG--TGVKAVSKSNVRMRMANHAKARCLGVASDVRVQVMGIEC 40
QAYI+G + V T Y E TG +S S+ + A+ CLGV ++V+ +G C
Sbjct: 15 QAYIEGTTTLQVWTAYQESDLTGFVRLSYSS-----EDCAEIDCLGVKKLIKVEKLGANC 69

Query: 39 LI 34
L+
Sbjct: 70 LL 71