BP913526
Clone id YMU001_000031_C01
Library
Length 554
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAAGAACATCCGCAACGACGACGGCAACGAGCTACAACTACAACAAGCACGGCATCAACA
ACATGAACAAGATCTACAGCTTCAACAGTTTGGACAAACATCAAAGGCTGATGTGCCTCA
ATTGGGGGCACAGAACTCCAATGGTCATAGTTTTCTGGCAGCAAGTGTTACTGTCTCCTC
TGACTGAAAGTGTATACCCACCTAACAAGTCTGCAAGCTGTTCTATACCACTCATCTCTG
GGGGACAGCCTCAGCCTTTATTTCCTGCTAGTGGCACTATTGCTTGGTTAACACAAGCTA
AAAATTCCTTCATTGCTGCTTCTGTGCATGCTCCTCATCTTGGTCAAGTGCTTCAACCAC
CTCTCCCTCCTGGACGTCCACCCCCGACATCTCAGGAAGGCAACCCACCACCACAAGTGC
TCAATACTAACATCTCTACTCTTCTTTCTTCACTTGTTGCTCAAGGACTAATCTCTGTCA
CCAGTGCAACTCCATCTTTACAACTGCCTTACTCGATTCCATCTATCTCTTTGACTCCAT
CCATCGAAAGCATG
■■Homology search results ■■ -
sp_hit_id O14215
Definition sp|O14215|PRI1_SCHPO DNA primase small subunit OS=Schizosaccharomyces pombe
Align length 25
Score (bit) 30.8
E-value 4.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913526|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_C01.
(554 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O14215|PRI1_SCHPO DNA primase small subunit OS=Schizosaccharo... 31 4.6
sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain... 30 6.0

>sp|O14215|PRI1_SCHPO DNA primase small subunit
OS=Schizosaccharomyces pombe GN=pri1 PE=1 SV=1
Length = 454

Score = 30.8 bits (68), Expect = 4.6
Identities = 11/25 (44%), Positives = 15/25 (60%)
Frame = +2

Query: 437 YSSFFTCCSRTNLCHQCNSIFTTAL 511
Y TCCS+TN+C +C T A+
Sbjct: 137 YDDVRTCCSKTNICEKCWPFITIAV 161


>sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain
protein 2A OS=Homo sapiens GN=BAZ2A PE=1 SV=3
Length = 1878

Score = 30.4 bits (67), Expect = 6.0
Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 13/92 (14%)
Frame = -1

Query: 413 WWWV-------AFLRCRGWTSRRERWL-KHLTKMRSMH-----RSSNEGIFSLC*PSNSA 273
WWW+ A L+ RE+ L KHL K R R S + IF P
Sbjct: 1412 WWWIRDPEMLDAMLKALHPRGIREKALHKHLNKHRDFLQEVCLRPSADPIFE---PRQLP 1468

Query: 272 TSRK*RLRLSPRDEWYRTACRLVRWVYTFSQR 177
++ + SP+++ Y T +++WV QR
Sbjct: 1469 AFQEGIMSWSPKEKTYETDLAVLQWVEELEQR 1500


tr_hit_id B6QVH6
Definition tr|B6QVH6|B6QVH6_PENMA DNA primase subunit Pri1, putative OS=Penicillium marneffei ATCC 18224
Align length 25
Score (bit) 34.3
E-value 4.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913526|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_C01.
(554 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6QVH6|B6QVH6_PENMA DNA primase subunit Pri1, putative OS=Pen... 34 4.6

>tr|B6QVH6|B6QVH6_PENMA DNA primase subunit Pri1, putative
OS=Penicillium marneffei ATCC 18224 GN=PMAA_012500 PE=4
SV=1
Length = 506

Score = 34.3 bits (77), Expect = 4.6
Identities = 12/25 (48%), Positives = 16/25 (64%)
Frame = +2

Query: 437 YSSFFTCCSRTNLCHQCNSIFTTAL 511
Y TCCS+ N+CH+C S T A+
Sbjct: 192 YDDVRTCCSKANICHKCWSFITMAI 216