BP913537
Clone id YMU001_000031_C12
Library
Length 443
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACTGGAAGAATTCGCGGCCCAGGAACAAGATTGCAGCAACCAACAAGCTGATAAGTCGG
TACATAGAAAGGCCGAAGTCTCCAGTTAAAAAGAATGCCATGGTACCACAATGCCAAACA
AACTTTCAGTGAACCCCTACAGACGGCTGCACGAGCTGTGACAAGACTGCCACCTCATCC
ATCATGGTTTTTTCAGAGCCTCAGCAGTTGGAAGATTACCCACTTAACGCAAAGGCACAG
CGATGAGGGCCAACAACTTCAAACTAAAACCTGCCAGCATTGCTTGAAGGGGGATAAAGC
AGCACCTCACATAAAAGGTTGCCATCATGCGAGAGAGTGACCACTCAGCTGTTTCCACGA
CAATATTTGACTGAAAACCCTTGCTCTCACTTGGCCTAATAAAAAGTCCATGTAAACCCG
ACCAGCTTTAAGCCTTCACCTTG
■■Homology search results ■■ -
sp_hit_id Q03185
Definition sp|Q03185|TS11_GIALA Major surface trophozoite antigen 11 OS=Giardia lamblia
Align length 36
Score (bit) 27.7
E-value 0.21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913537|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_C12.
(423 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q03185|TS11_GIALA Major surface trophozoite antigen 11 OS=Gia... 28 0.21
sp|A3DKS1|SYL_STAMF Leucyl-tRNA synthetase OS=Staphylothermus ma... 31 2.3
sp|Q69ZN7|MYOF_MOUSE Myoferlin OS=Mus musculus GN=Myof PE=1 SV=2 30 5.0
sp|Q9NZM1|MYOF_HUMAN Myoferlin OS=Homo sapiens GN=FER1L3 PE=1 SV=1 30 5.0
sp|Q6GPH4|XAF1_HUMAN XIAP-associated factor 1 OS=Homo sapiens GN... 29 6.6
sp|Q5RJL2|CQ095_RAT UPF0563 protein C17orf95 homolog OS=Rattus n... 29 8.6
sp|Q04778|ALSR_BACSU HTH-type transcriptional regulator alsR OS=... 29 8.6

>sp|Q03185|TS11_GIALA Major surface trophozoite antigen 11
OS=Giardia lamblia GN=TSP11 PE=3 SV=1
Length = 667

Score = 27.7 bits (60), Expect(2) = 0.21
Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 4/36 (11%)
Frame = +2

Query: 53 PKSPVKKN----AMVPQCQTNFQ*TPTDGCTSCDKT 148
PK+P + N A +C F TP++G +SC++T
Sbjct: 144 PKAPGEDNTPKAATCTKCAAGFLHTPSEGLSSCEET 179



Score = 26.2 bits (56), Expect(2) = 0.21
Identities = 9/18 (50%), Positives = 12/18 (66%)
Frame = +3

Query: 246 KTCQHCLKGDKAAPHIKG 299
KTC+ C G AP++KG
Sbjct: 195 KTCKSCTGGSSEAPNVKG 212


>sp|A3DKS1|SYL_STAMF Leucyl-tRNA synthetase OS=Staphylothermus
marinus (strain ATCC 43588 / DSM 3639 / F1) GN=leuS PE=3
SV=1
Length = 969

Score = 30.8 bits (68), Expect = 2.3
Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 7/51 (13%)
Frame = +3

Query: 141 TRLPPHPSWFFQSLSS-------WKITHLTQRHSDEGQQLQTKTCQHCLKG 272
TRLP P W +SLS + I HL ++H+ + +QL+ + + G
Sbjct: 522 TRLPFDPEWVIESLSDSTIYMAFYTIAHLIRKHNIKPEQLKPQVFDYVFLG 572


>sp|Q69ZN7|MYOF_MOUSE Myoferlin OS=Mus musculus GN=Myof PE=1 SV=2
Length = 2048

Score = 29.6 bits (65), Expect = 5.0
Identities = 15/43 (34%), Positives = 21/43 (48%)
Frame = +3

Query: 96 KQTFSEPLQTAARAVTRLPPHPSWFFQSLSSWKITHLTQRHSD 224
K+ ++ + ARA+ L W + SL WK H QR SD
Sbjct: 1015 KKDLTQTASSTARAMEELEDREGWEYASLIGWKF-HWKQRSSD 1056


>sp|Q9NZM1|MYOF_HUMAN Myoferlin OS=Homo sapiens GN=FER1L3 PE=1 SV=1
Length = 2061

Score = 29.6 bits (65), Expect = 5.0
Identities = 15/43 (34%), Positives = 21/43 (48%)
Frame = +3

Query: 96 KQTFSEPLQTAARAVTRLPPHPSWFFQSLSSWKITHLTQRHSD 224
K+ ++ + ARA+ L W + SL WK H QR SD
Sbjct: 1028 KKDLTQTASSTARAMEELQDQEGWEYASLIGWKF-HWKQRSSD 1069


>sp|Q6GPH4|XAF1_HUMAN XIAP-associated factor 1 OS=Homo sapiens
GN=XAF1 PE=1 SV=1
Length = 301

Score = 29.3 bits (64), Expect = 6.6
Identities = 14/53 (26%), Positives = 24/53 (45%)
Frame = +2

Query: 56 KSPVKKNAMVPQCQTNFQ*TPTDGCTSCDKTATSSIMVFSEPQQLEDYPLNAK 214
+ PV K M C+ Q GCT C ++ S + F + + ++ P+ K
Sbjct: 38 EEPVPKETMEEHCKLEHQQV---GCTMCQQSMQKSSLEFHKANECQERPVECK 87


>sp|Q5RJL2|CQ095_RAT UPF0563 protein C17orf95 homolog OS=Rattus
norvegicus PE=2 SV=1
Length = 225

Score = 28.9 bits (63), Expect = 8.6
Identities = 12/32 (37%), Positives = 20/32 (62%)
Frame = -2

Query: 356 FQSNIVVETAEWSLSRMMATFYVRCCFIPLQA 261
F S V +A+WSL ++ + +RC IPL++
Sbjct: 163 FWSTYQVRSADWSLEGLLYKWDMRCVHIPLES 194


>sp|Q04778|ALSR_BACSU HTH-type transcriptional regulator alsR
OS=Bacillus subtilis GN=alsR PE=4 SV=1
Length = 302

Score = 28.9 bits (63), Expect = 8.6
Identities = 15/49 (30%), Positives = 25/49 (51%)
Frame = -2

Query: 407 SWSGLHGLFIRPSESKGFQSNIVVETAEWSLSRMMATFYVRCCFIPLQA 261
+W L+ FI+ E GF+ NIV E E+ + + + + F+P A
Sbjct: 198 AWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMTFVPSSA 246


tr_hit_id A8BC41
Definition tr|A8BC41|A8BC41_GIALA VSP with INR OS=Giardia lamblia ATCC 50803
Align length 36
Score (bit) 27.7
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913537|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_C12.
(423 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8BC41|A8BC41_GIALA VSP with INR OS=Giardia lamblia ATCC 5080... 28 2.2

>tr|A8BC41|A8BC41_GIALA VSP with INR OS=Giardia lamblia ATCC 50803
GN=GL50803_115797 PE=4 SV=1
Length = 682

Score = 27.7 bits (60), Expect(2) = 2.2
Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 4/36 (11%)
Frame = +2

Query: 53 PKSPVKKN----AMVPQCQTNFQ*TPTDGCTSCDKT 148
PK+P + N A +C F TP++G +SC++T
Sbjct: 159 PKAPGEDNTPKAATCTKCAAGFLHTPSEGLSSCEET 194



Score = 26.2 bits (56), Expect(2) = 2.2
Identities = 9/18 (50%), Positives = 12/18 (66%)
Frame = +3

Query: 246 KTCQHCLKGDKAAPHIKG 299
KTC+ C G AP++KG
Sbjct: 210 KTCKSCTGGSSEAPNVKG 227