BP913538
Clone id YMU001_000031_D01
Library
Length 207
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCTGTATCTGAAAATAATCATCCAAGGCTTCTCAAAAAGTATCCAGTGAATCCTTGGAGC
TTCTCCCAAAGAGGATAGAGTAATGGATGAACACTGGTTAAATTATTCCTACATAATGAG
GTTTCGGCAAAGACTTTCCCTTGCCTCATTCGCTTCATAACTATACGCATCCTCCAGATG
GTCCAGATCATCTGAATCATGCTGAGT
■■Homology search results ■■ -
sp_hit_id O18158
Definition sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans
Align length 32
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913538|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_D01.
(207 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylgl... 29 6.4

>sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase OS=Caenorhabditis
elegans GN=ogt-1 PE=1 SV=2
Length = 1151

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 3/32 (9%)
Frame = -2

Query: 155 KRMRQGKVFAETSLCRNNLTSVHP---LLYPL 69
KR+R+ E LC+ L SVHP +LYPL
Sbjct: 588 KRVRKLVQIVEDQLCKKRLPSVHPHHSMLYPL 619


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913538|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_D01.
(207 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******