BP913546
Clone id YMU001_000031_D09
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGGATCTCTTGATGGATGCCAAAGTTGTGAAGAAAGAGGATTTCTGGATACTGGCGGAGC
AACACGGCAACTTTCTAGAGCTTCCCCCTCTACTTGTGGATATTCGCCGAAAGAAGCTAG
AAGAGTTTAGAGAGTAAATGATTACGGAGAAAAGGGCAGTTTTGCCGTAACGATAAGACA
AAAGAATCTAGGTACACAATTTTTGTAACAGGAACGTAAACCCCACTTTGGATCGGGCGG
AGCAACAGGCAGCTGAGAGTCGGTGTCGATAACTAGCATGTTTTTCTGAAGAGGGCAGTT
GGGTGGCCCTTATTTCAGAAGATGGATGCAGACATGAGCAGGGTGCATATGTACTGTAGC
CTGCTGATACAAGGGAACTTCTCATGGAAAACAGCTCAAATCATTGCCCCAATTAAGAGG
GCTACTAGCTTTGGGGTGCTTGGAAGTGGTAGTTTGGAATAAGTTGTTTAGGTCTACAGA
GTTCCTCCATTTATCCCAAACAGGGATGCAGATTGTAAACAAATGATGGTAATAGTCATG
ATTATGTT
■■Homology search results ■■ -
sp_hit_id Q8NE79
Definition sp|Q8NE79|POPD1_HUMAN Blood vessel epicardial substance OS=Homo sapiens
Align length 41
Score (bit) 32.0
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913546|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_D09.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8NE79|POPD1_HUMAN Blood vessel epicardial substance OS=Homo ... 32 2.0
sp|Q47YH9|ZIPA_COLP3 Cell division protein zipA homolog OS=Colwe... 30 5.9

>sp|Q8NE79|POPD1_HUMAN Blood vessel epicardial substance OS=Homo
sapiens GN=BVES PE=2 SV=1
Length = 360

Score = 32.0 bits (71), Expect = 2.0
Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 13/41 (31%)
Frame = +2

Query: 413 LRGLLALGC-------------LEVVVWNKLFRSTEFLHLS 496
LRG+L LGC L++++WN +F LHLS
Sbjct: 69 LRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLS 109


>sp|Q47YH9|ZIPA_COLP3 Cell division protein zipA homolog
OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
GN=zipA PE=3 SV=1
Length = 380

Score = 30.4 bits (67), Expect = 5.9
Identities = 15/50 (30%), Positives = 24/50 (48%)
Frame = -3

Query: 375 PLYQQATVHMHPAHVCIHLLK*GPPNCPLQKNMLVIDTDSQLPVAPPDPK 226
PLY+Q PA I+ + P L+++ + ID D+Q+ PK
Sbjct: 181 PLYEQPVTQAKPARTPINKVSKTPSKATLKRDQIEIDFDNQMSEQAAAPK 230


tr_hit_id A7P762
Definition tr|A7P762|A7P762_VITVI Chromosome chr9 scaffold_7, whole genome shotgun sequence OS=Vitis vinifera
Align length 54
Score (bit) 42.0
E-value 0.021
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913546|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_D09.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P762|A7P762_VITVI Chromosome chr9 scaffold_7, whole genome ... 42 0.021
tr|A9SCI8|A9SCI8_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.68
tr|B7X5A3|B7X5A3_COMTE Transcriptional regulator, LysR family OS... 35 2.6
tr|A8HTL2|A8HTL2_CHLRE Predicted protein OS=Chlamydomonas reinha... 34 4.4
tr|Q0CSX9|Q0CSX9_ASPTN Predicted protein OS=Aspergillus terreus ... 33 9.8

>tr|A7P762|A7P762_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034338001
PE=4 SV=1
Length = 830

Score = 42.0 bits (97), Expect = 0.021
Identities = 19/54 (35%), Positives = 35/54 (64%)
Frame = +3

Query: 3 DLLMDAKVVKKEDFWILAEQHGNFLELPPLLVDIRRKKLEEFRE*MITEKRAVL 164
D L+ K + K++F+ L E HG+ +PP ++DIR K +F+E M++++ A +
Sbjct: 773 DELVQKKSLTKQEFFRLVEVHGSLKPMPPNILDIRAAKRIQFQERMMSQREAAV 826


>tr|A9SCI8|A9SCI8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_210834 PE=4 SV=1
Length = 802

Score = 37.0 bits (84), Expect = 0.68
Identities = 19/53 (35%), Positives = 32/53 (60%)
Frame = +3

Query: 3 DLLMDAKVVKKEDFWILAEQHGNFLELPPLLVDIRRKKLEEFRE*MITEKRAV 161
+ L+ +V+++ +F L +GN P V+IR + L F+E MITEKR++
Sbjct: 748 EALVKDRVIRQVEFSQLVSTYGNLDPPPSTPVEIRDRSLAAFQEAMITEKRSI 800


>tr|B7X5A3|B7X5A3_COMTE Transcriptional regulator, LysR family
OS=Comamonas testosteroni KF-1 GN=CtesDRAFT_PD1841 PE=4
SV=1
Length = 316

Score = 35.0 bits (79), Expect = 2.6
Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 2/64 (3%)
Frame = -3

Query: 519 FTICIPVWDK--WRNSVDLNNLFQTTTSKHPKASSPLNWGNDLSCFP*EVPLYQQATVHM 346
F C+P WR +DL L Q T + +P N+ N ++C QQA +H
Sbjct: 177 FVCCLPSEHALAWRAEIDLRELAQDTFVMFAREVAPANYDNVIACL-------QQAGIHP 229

Query: 345 HPAH 334
H H
Sbjct: 230 HTRH 233


>tr|A8HTL2|A8HTL2_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=MOT27 PE=4 SV=1
Length = 573

Score = 34.3 bits (77), Expect = 4.4
Identities = 26/79 (32%), Positives = 33/79 (41%), Gaps = 3/79 (3%)
Frame = -3

Query: 435 PKASSPLNWGN---DLSCFP*EVPLYQQATVHMHPAHVCIHLLK*GPPNCPLQKNMLVID 265
P A PL WG D S F + L + V + AH L PN PLQ L +
Sbjct: 364 PAAGLPLFWGEGARDRSRFAYALYLLSRDVVQVMEAHGLPPLA----PNAPLQNLFLDVK 419

Query: 264 TDSQLPVAPPDPKWGLRSC 208
LP+A +W + SC
Sbjct: 420 LHKALPLARQKCRWRMSSC 438


>tr|Q0CSX9|Q0CSX9_ASPTN Predicted protein OS=Aspergillus terreus
(strain NIH 2624) GN=ATEG_03205 PE=4 SV=1
Length = 543

Score = 33.1 bits (74), Expect = 9.8
Identities = 27/83 (32%), Positives = 34/83 (40%), Gaps = 11/83 (13%)
Frame = -3

Query: 450 TTSKHPKASSPLNWGNDLSCFP*E---------VPLYQQATVHMHPAHVCIHLLK--*GP 304
+TSK P S P +WG DL C P E PL Q +VH L+
Sbjct: 59 STSKVPHQSPPQSWGKDLWCMPQEAAVSSADQDTPLAFQDSVHPPAVSDLSANLEASSAA 118

Query: 303 PNCPLQKNMLVIDTDSQLPVAPP 235
PNCP T+++ P PP
Sbjct: 119 PNCP---------TENRSPSTPP 132