BP913585
Clone id YMU001_000031_H05
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000031_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCTCGAGTTAATGATGATGATGATGGTGGGATCGTGTCGGCCATATGGGTGAGAACATT
GACCGCATCTGACATATCACAATGAAGCTTTGTGACAGAATCACCTCGACCAAACTCTTC
CTCGTAACCATAAGCTATGTAAGTTTTAGGTCCAAGGTCTGGTTTTGCAATGTTCTTCGG
TAGCTTGGTGGCAAGATTCAGCATGCCACGAGTAGGATGTGTGTAATCATGAAATGGGAG
AGCACTGACAAACTCTGCACCATGACGTGGTAGCCTCTCGTGGAAAAAATTTGCAGGCGG
CCAATCTTTGAGCTTCAGCATTTCAGGCCAGCCACCTCTATGCATACGATCCTCTGCATA
ACCCCTAAAGAACTGACGAATGTTGATCTCAACCTCACACCAGTCAAGGCAGTCGATAGC
CTTGACAGTCTTGGTTTCTTCAGCAAACTTGTATTTGGTGGTCTCCCTAAAAGCCCGCCA
CATGACCATAGGTTCCCAGCTTAATCCCTTGGTCTTATCCAAGACATTTCTTACAATCA
■■Homology search results ■■ -
sp_hit_id Q6ZPY7
Definition sp|Q6ZPY7|JHD2B_MOUSE JmjC domain-containing histone demethylation protein 2B OS=Mus musculus
Align length 169
Score (bit) 92.4
E-value 1.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913585|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_H05.
(539 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6ZPY7|JHD2B_MOUSE JmjC domain-containing histone demethylati... 92 1e-18
sp|Q7LBC6|JHD2B_HUMAN JmjC domain-containing histone demethylati... 92 1e-18
sp|Q9Y4C1|JHD2A_HUMAN JmjC domain-containing histone demethylati... 84 3e-16
sp|Q5ZIX8|JHD2A_CHICK JmjC domain-containing histone demethylati... 84 4e-16
sp|Q63679|JHD2A_RAT JmjC domain-containing histone demethylation... 83 7e-16
sp|Q6PCM1|JHD2A_MOUSE JmjC domain-containing histone demethylati... 83 7e-16
sp|Q15652|JHD2C_HUMAN Probable JmjC domain-containing histone de... 80 6e-15
sp|Q69ZK6|JHD2C_MOUSE Probable JmjC domain-containing histone de... 79 1e-14
sp|Q5HZN1|JD2AB_XENLA JmjC domain-containing histone demethylati... 78 3e-14
sp|Q6IRB8|JD2AA_XENLA JmjC domain-containing histone demethylati... 78 3e-14
sp|O43593|HAIR_HUMAN Protein hairless OS=Homo sapiens GN=HR PE=1... 43 0.001
sp|P97609|HAIR_RAT Protein hairless OS=Rattus norvegicus GN=Hr P... 42 0.002
sp|Q61645|HAIR_MOUSE Protein hairless OS=Mus musculus GN=Hr PE=2... 42 0.002
sp|Q8NGG8|OR8B3_HUMAN Olfactory receptor 8B3 OS=Homo sapiens GN=... 32 2.6
sp|P98153|IDD_HUMAN Integral membrane protein DGCR2/IDD OS=Homo ... 30 7.5
sp|P78022|RPOD_MYCPN RNA polymerase sigma factor rpoD OS=Mycopla... 30 9.8
sp|P47491|RPOD_MYCGE RNA polymerase sigma factor rpoD OS=Mycopla... 30 9.8
sp|Q8TGI1|ATG1_PICPA Serine/threonine-protein kinase ATG1 OS=Pic... 30 9.8

>sp|Q6ZPY7|JHD2B_MOUSE JmjC domain-containing histone demethylation
protein 2B OS=Mus musculus GN=Jmjd1b PE=2 SV=2
Length = 1562

Score = 92.4 bits (228), Expect = 1e-18
Identities = 56/169 (33%), Positives = 84/169 (49%), Gaps = 4/169 (2%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEV-EINIRQFFRG 361
+V V K K W+P + F + + V ++C + + ++ +R F+ G
Sbjct: 1217 LVSGVHKKLKSELWKPEAFSQEFGD----------QDVDLVNCRNCAIISDVKVRDFWDG 1266

Query: 360 Y---AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLA 190
+ + G P +LKLKDWPP F + +P + + LP +YT G LNLA
Sbjct: 1267 FEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRD-GRLNLA 1325

Query: 189 TKLPKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
++LP +PDLGPK Y AYG R T LH D+SDAVNV+ ++
Sbjct: 1326 SRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYV 1374


>sp|Q7LBC6|JHD2B_HUMAN JmjC domain-containing histone demethylation
protein 2B OS=Homo sapiens GN=JMJD1B PE=1 SV=1
Length = 1761

Score = 92.4 bits (228), Expect = 1e-18
Identities = 56/169 (33%), Positives = 84/169 (49%), Gaps = 4/169 (2%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEV-EINIRQFFRG 361
+V V K K W+P + F + + V ++C + + ++ +R F+ G
Sbjct: 1416 LVSGVHKKLKSELWKPEAFSQEFGD----------QDVDLVNCRNCAIISDVKVRDFWDG 1465

Query: 360 Y---AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLA 190
+ + G P +LKLKDWPP F + +P + + LP +YT G LNLA
Sbjct: 1466 FEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRD-GRLNLA 1524

Query: 189 TKLPKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
++LP +PDLGPK Y AYG R T LH D+SDAVNV+ ++
Sbjct: 1525 SRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYV 1573


>sp|Q9Y4C1|JHD2A_HUMAN JmjC domain-containing histone demethylation
protein 2A OS=Homo sapiens GN=JMJD1A PE=1 SV=3
Length = 1321

Score = 84.3 bits (207), Expect = 3e-16
Identities = 44/115 (38%), Positives = 65/115 (56%), Gaps = 2/115 (1%)
Frame = -3

Query: 381 IRQFFRGYAE--DRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTR 208
+ F+ G+ + +R+ P +LKLKDWPP F + +P + ++ +P +YT
Sbjct: 1020 VGDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRD- 1078

Query: 207 GMLNLATKLPKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
G LNLA++LP +PDLGPK Y AYG R T LH D+SDA NV+ ++
Sbjct: 1079 GKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYV 1133


>sp|Q5ZIX8|JHD2A_CHICK JmjC domain-containing histone demethylation
protein 2A OS=Gallus gallus GN=JMJD1A PE=2 SV=1
Length = 1325

Score = 84.0 bits (206), Expect = 4e-16
Identities = 42/97 (43%), Positives = 56/97 (57%)
Frame = -3

Query: 333 GWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDL 154
G P +LKLKDWPP F + +P + + +P +YT G LNLA++LP +PDL
Sbjct: 1042 GEPMVLKLKDWPPGEDFRDMMPSRFDDLMKNIPLPEYTR-RGGKLNLASRLPNYFVRPDL 1100

Query: 153 GPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
GPK Y AYG R T LH D+SDA NV+ ++
Sbjct: 1101 GPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYV 1137


>sp|Q63679|JHD2A_RAT JmjC domain-containing histone demethylation
protein 2A OS=Rattus norvegicus GN=Jmjd1a PE=2 SV=1
Length = 1214

Score = 83.2 bits (204), Expect = 7e-16
Identities = 41/95 (43%), Positives = 56/95 (58%)
Frame = -3

Query: 327 PEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDLGP 148
P +LKLKDWPP F + +P + ++ +P +YT G LNLA++LP +PDLGP
Sbjct: 926 PMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRD-GKLNLASRLPNYFVRPDLGP 984

Query: 147 KTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
K Y AYG R T LH D+SDA NV+ ++
Sbjct: 985 KMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYV 1019


>sp|Q6PCM1|JHD2A_MOUSE JmjC domain-containing histone demethylation
protein 2A OS=Mus musculus GN=Jmjd1a PE=2 SV=1
Length = 1323

Score = 83.2 bits (204), Expect = 7e-16
Identities = 41/95 (43%), Positives = 56/95 (58%)
Frame = -3

Query: 327 PEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDLGP 148
P +LKLKDWPP F + +P + ++ +P +YT G LNLA++LP +PDLGP
Sbjct: 1042 PMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRD-GKLNLASRLPNYFVRPDLGP 1100

Query: 147 KTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
K Y AYG R T LH D+SDA NV+ ++
Sbjct: 1101 KMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYV 1135


>sp|Q15652|JHD2C_HUMAN Probable JmjC domain-containing histone
demethylation protein 2C OS=Homo sapiens GN=JMJD1C PE=1
SV=2
Length = 2540

Score = 80.1 bits (196), Expect = 6e-15
Identities = 46/150 (30%), Positives = 76/150 (50%), Gaps = 3/150 (2%)
Frame = -3

Query: 483 MWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGYAE---DRMHRGGWPEMLK 313
+W+A E+ F + + ++C D N+++F+ G+ E + ++ G +LK
Sbjct: 2205 LWKA--ESISLDFGDHQADL--LNCKDSIISNANVKEFWDGFEEVSKRQKNKSGETVVLK 2260

Query: 312 LKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDLGPKTYIA 133
LKDWP F +P + + +LP +Y +P G NLA+ LP +PDLGP+ A
Sbjct: 2261 LKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNP-EGKFNLASHLPGFFVRPDLGPRLCSA 2319

Query: 132 YGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
YG T LH ++SD VN+L ++
Sbjct: 2320 YGVVAAKDHDIGTTNLHIEVSDVVNILVYV 2349


>sp|Q69ZK6|JHD2C_MOUSE Probable JmjC domain-containing histone
demethylation protein 2C OS=Mus musculus GN=Jmjd1c PE=2
SV=2
Length = 2350

Score = 79.3 bits (194), Expect = 1e-14
Identities = 48/150 (32%), Positives = 75/150 (50%), Gaps = 3/150 (2%)
Frame = -3

Query: 483 MWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGYAE---DRMHRGGWPEMLK 313
+W+A E+ F + + ++C D N+++F+ G+ E + ++GG +LK
Sbjct: 2015 LWKA--ESISLDFGDHQADL--LNCKDSIVSNANVKEFWDGFEEVSKRQKNKGGETVVLK 2070

Query: 312 LKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDLGPKTYIA 133
LKD P F +P +F+ LP +Y +P G NLA+ LP +PDLGP+ A
Sbjct: 2071 LKDCPSGEDFKAMMPTRYEDFLRCLPLPEYCNP-EGKFNLASHLPGFFVRPDLGPRLCSA 2129

Query: 132 YGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
YG T LH + SD VNVL ++
Sbjct: 2130 YGVAAAKDHDIGTTNLHIEASDVVNVLVYV 2159


>sp|Q5HZN1|JD2AB_XENLA JmjC domain-containing histone demethylation
protein 2A-B OS=Xenopus laevis GN=jmjd1a-B PE=2 SV=1
Length = 1334

Score = 77.8 bits (190), Expect = 3e-14
Identities = 39/93 (41%), Positives = 53/93 (56%)
Frame = -3

Query: 321 MLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDLGPKT 142
+LKLKDWPP F + + + ++ +P +YT G LNLA +LP +PDLGPK
Sbjct: 1055 VLKLKDWPPGEDFRDTMLSRFEDLMNNIPLPEYTR-REGKLNLAARLPTYFVRPDLGPKM 1113

Query: 141 YIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
Y AYG R T LH D+SDA NV+ ++
Sbjct: 1114 YNAYGLITPEDRKYGTTNLHLDVSDAANVMVYV 1146


>sp|Q6IRB8|JD2AA_XENLA JmjC domain-containing histone demethylation
protein 2A-A OS=Xenopus laevis GN=jmjd1a-A PE=2 SV=1
Length = 1331

Score = 77.8 bits (190), Expect = 3e-14
Identities = 39/93 (41%), Positives = 53/93 (56%)
Frame = -3

Query: 321 MLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLPKNIAKPDLGPKT 142
+LKLKDWPP F + + + ++ +P +YT G LNLA +LP +PDLGPK
Sbjct: 1052 VLKLKDWPPGEDFRDTMLSRFEDLMNNIPLPEYTR-REGKLNLAARLPAYFVRPDLGPKM 1110

Query: 141 YIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHM 43
Y AYG R T LH D+SDA NV+ ++
Sbjct: 1111 YNAYGLITPEDRKYGTTNLHLDVSDATNVMVYV 1143


tr_hit_id A7QWE7
Definition tr|A7QWE7|A7QWE7_VITVI Chromosome undetermined scaffold_203, whole genome shotgun sequence OS=Vitis vinifera
Align length 167
Score (bit) 282.0
E-value 9.0e-75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913585|Adiantum capillus-veneris mRNA, clone:
YMU001_000031_H05.
(539 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QWE7|A7QWE7_VITVI Chromosome undetermined scaffold_203, who... 282 9e-75
tr|A9U241|A9U241_PHYPA Predicted protein OS=Physcomitrella paten... 271 2e-71
tr|A5AKW0|A5AKW0_VITVI Putative uncharacterized protein OS=Vitis... 269 8e-71
tr|Q9SV29|Q9SV29_ARATH Putative uncharacterized protein AT4g0099... 263 4e-69
tr|Q8VYB9|Q8VYB9_ARATH Putative uncharacterized protein At4g0099... 263 4e-69
tr|A7PTL4|A7PTL4_VITVI Chromosome undetermined scaffold_30, whol... 256 4e-67
tr|A7QF33|A7QF33_VITVI Chromosome chr16 scaffold_86, whole genom... 256 7e-67
tr|A5BYR6|A5BYR6_VITVI Putative uncharacterized protein OS=Vitis... 256 7e-67
tr|O04698|O04698_PEA Chloroplast DNA-binding protein PD3 OS=Pisu... 252 8e-66
tr|O82022|O82022_MEDTR ENBP1 protein OS=Medicago truncatula GN=E... 251 2e-65
tr|Q41700|Q41700_VICSA ENBP1 protein OS=Vicia sativa GN=ENBP1 PE... 250 4e-65
tr|A7Q7J4|A7Q7J4_VITVI Chromosome undetermined scaffold_60, whol... 250 4e-65
tr|Q6K7P0|Q6K7P0_ORYSJ Os02g0828900 protein OS=Oryza sativa subs... 249 6e-65
tr|Q6K7N9|Q6K7N9_ORYSJ Putative DNA-binding protein PD3, chlorop... 249 6e-65
tr|A3ACY6|A3ACY6_ORYSJ Putative uncharacterized protein OS=Oryza... 249 6e-65
tr|B8AF76|B8AF76_ORYSI Putative uncharacterized protein OS=Oryza... 248 2e-64
tr|A5C8Q5|A5C8Q5_VITVI Putative uncharacterized protein OS=Vitis... 246 4e-64
tr|O48794|O48794_ARATH F24O1.3 OS=Arabidopsis thaliana PE=4 SV=1 237 3e-61
tr|A9U2N6|A9U2N6_PHYPA Predicted protein OS=Physcomitrella paten... 236 6e-61
tr|A7QUK3|A7QUK3_VITVI Chromosome chr10 scaffold_179, whole geno... 231 2e-59
tr|A5AE68|A5AE68_VITVI Putative uncharacterized protein OS=Vitis... 231 2e-59
tr|Q6AUV7|Q6AUV7_ORYSJ JmjC domain containing protein OS=Oryza s... 227 3e-58
tr|Q10J83|Q10J83_ORYSJ JmjC domain containing protein, expressed... 227 3e-58
tr|Q10J82|Q10J82_ORYSJ JmjC domain containing protein, expressed... 227 3e-58
tr|B8AKE7|B8AKE7_ORYSI Putative uncharacterized protein OS=Oryza... 227 3e-58
tr|A3AJC9|A3AJC9_ORYSJ Putative uncharacterized protein OS=Oryza... 227 3e-58
tr|Q9SSE9|Q9SSE9_ARATH MLP3.6 protein OS=Arabidopsis thaliana GN... 223 5e-57
tr|A9RSS8|A9RSS8_PHYPA Predicted protein (Fragment) OS=Physcomit... 220 4e-56
tr|O65384|O65384_ARATH F12F1.18 protein OS=Arabidopsis thaliana ... 216 5e-55
tr|B8AG57|B8AG57_ORYSI Putative uncharacterized protein OS=Oryza... 216 8e-55

>tr|A7QWE7|A7QWE7_VITVI Chromosome undetermined scaffold_203, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00008625001 PE=4 SV=1
Length = 782

Score = 282 bits (721), Expect = 9e-75
Identities = 133/167 (79%), Positives = 141/167 (84%), Gaps = 1/167 (0%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRET-TKYKFAEETKTVKAIDCLDWCEVEINIRQFFRG 361
IVRNVLDKT GLSWEPMVMWRAFRET K KF EET+TVKAIDCLDWCEVEINI QFF G
Sbjct: 310 IVRNVLDKTSGLSWEPMVMWRAFRETGAKTKFKEETRTVKAIDCLDWCEVEINIHQFFAG 369

Query: 360 YAEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKL 181
Y E RMH+GGWPEMLKLKDWP + F ERLPRHGAEF++ALP+ DYT P G LN+ATKL
Sbjct: 370 YLEGRMHKGGWPEMLKLKDWPSSTLFEERLPRHGAEFIAALPYCDYTDPKSGFLNIATKL 429

Query: 180 PKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMA 40
P KPDLGPKTYIAYG+ E GRGDSVTKLHCDMSDAVNVLTH A
Sbjct: 430 PTESLKPDLGPKTYIAYGFPLELGRGDSVTKLHCDMSDAVNVLTHTA 476


>tr|A9U241|A9U241_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_200454 PE=4 SV=1
Length = 689

Score = 271 bits (692), Expect = 2e-71
Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGY 358
IVR+VL+ T GLSWEP+VMWRA RETTK KF ++TKTVKA+DCLDW EVEINI QFF+GY
Sbjct: 325 IVRDVLECTTGLSWEPLVMWRAVRETTKGKFKDDTKTVKALDCLDWREVEINIHQFFKGY 384

Query: 357 AEDRMHR--GGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATK 184
E R+ R GWPEMLKLKDWPP+N F ERLPRHGAEF+ ALPFH+YT P++GMLNLA +
Sbjct: 385 EEGRLQRKPDGWPEMLKLKDWPPSNHFEERLPRHGAEFLHALPFHEYTDPSKGMLNLAAQ 444

Query: 183 LPKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMAD 37
LPK KPDLGPKTYIAYG E G GDSVTKLHCDMSDAVNVLTH A+
Sbjct: 445 LPKEAIKPDLGPKTYIAYGLRHELGMGDSVTKLHCDMSDAVNVLTHSAE 493


>tr|A5AKW0|A5AKW0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009615 PE=4 SV=1
Length = 1160

Score = 269 bits (687), Expect = 8e-71
Identities = 126/159 (79%), Positives = 134/159 (84%), Gaps = 1/159 (0%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRET-TKYKFAEETKTVKAIDCLDWCEVEINIRQFFRG 361
IVRNVLDKT GLSWEPMVMWRAFRET K KF EET+TVKAIDCLDWCEVEINI QFF G
Sbjct: 525 IVRNVLDKTSGLSWEPMVMWRAFRETGAKTKFKEETRTVKAIDCLDWCEVEINIHQFFAG 584

Query: 360 YAEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKL 181
Y E RMH+GGWPEMLKLKDWP + F ERLPRHGAEF++ALP+ DYT P G LN+ATKL
Sbjct: 585 YLEGRMHKGGWPEMLKLKDWPSSTLFEERLPRHGAEFIAALPYCDYTDPKSGFLNIATKL 644

Query: 180 PKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDA 64
P KPDLGPKTYIAYG+ E GRGDSVTKLHCDMSDA
Sbjct: 645 PTESLKPDLGPKTYIAYGFPLELGRGDSVTKLHCDMSDA 683


>tr|Q9SV29|Q9SV29_ARATH Putative uncharacterized protein AT4g00990
(Fragment) OS=Arabidopsis thaliana GN=AT4g00990 PE=4
SV=1
Length = 730

Score = 263 bits (672), Expect = 4e-69
Identities = 124/174 (71%), Positives = 139/174 (79%), Gaps = 3/174 (1%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFA--EETKTVKAIDCLDWCEVEINIRQFFR 364
IVRNVL+KT GLSWEPMVMWRA RE + EET VKA+DCLDWCEVEIN+ QFF
Sbjct: 249 IVRNVLEKTSGLSWEPMVMWRACREMDPKRKGTEEETTKVKALDCLDWCEVEINLHQFFE 308

Query: 363 GYAEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATK 184
GY E RMH+ GWPEMLKLKDWPP++ F +RLPRH AEF++ALPF DYT P G+LNLAT+
Sbjct: 309 GYLEGRMHKNGWPEMLKLKDWPPSDLFEKRLPRHNAEFIAALPFFDYTDPKSGILNLATR 368

Query: 183 LPKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMADT-IPP 25
P+ KPDLGPKTYIAYG+ EE RGDSVTKLHCD+SDAVNVLTH A IPP
Sbjct: 369 FPEGSLKPDLGPKTYIAYGFHEELNRGDSVTKLHCDISDAVNVLTHTAKVEIPP 422


>tr|Q8VYB9|Q8VYB9_ARATH Putative uncharacterized protein At4g00990
OS=Arabidopsis thaliana GN=At4g00990 PE=2 SV=1
Length = 840

Score = 263 bits (672), Expect = 4e-69
Identities = 124/174 (71%), Positives = 139/174 (79%), Gaps = 3/174 (1%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFA--EETKTVKAIDCLDWCEVEINIRQFFR 364
IVRNVL+KT GLSWEPMVMWRA RE + EET VKA+DCLDWCEVEIN+ QFF
Sbjct: 393 IVRNVLEKTSGLSWEPMVMWRACREMDPKRKGTEEETTKVKALDCLDWCEVEINLHQFFE 452

Query: 363 GYAEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATK 184
GY E RMH+ GWPEMLKLKDWPP++ F +RLPRH AEF++ALPF DYT P G+LNLAT+
Sbjct: 453 GYLEGRMHKNGWPEMLKLKDWPPSDLFEKRLPRHNAEFIAALPFFDYTDPKSGILNLATR 512

Query: 183 LPKNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMADT-IPP 25
P+ KPDLGPKTYIAYG+ EE RGDSVTKLHCD+SDAVNVLTH A IPP
Sbjct: 513 FPEGSLKPDLGPKTYIAYGFHEELNRGDSVTKLHCDISDAVNVLTHTAKVEIPP 566


>tr|A7PTL4|A7PTL4_VITVI Chromosome undetermined scaffold_30, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00023403001 PE=4 SV=1
Length = 904

Score = 256 bits (655), Expect = 4e-67
Identities = 120/167 (71%), Positives = 137/167 (82%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGY 358
IV +VL+ T GLSWEPMVMWRAFR+ + K ++ + KAIDCLDWCEVEINI QFF+GY
Sbjct: 450 IVSDVLEFTSGLSWEPMVMWRAFRKVSYTKSSQLAE--KAIDCLDWCEVEINIHQFFKGY 507

Query: 357 AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLP 178
+E R HR WPEMLKLKDWPP+N F ERLPRHGAEF+S+LP+ +YTHP G+LNLA KLP
Sbjct: 508 SEGRAHRNLWPEMLKLKDWPPSNLFQERLPRHGAEFISSLPYLEYTHPRSGLLNLAAKLP 567

Query: 177 KNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMAD 37
+ KPDLGPKTYIAYG EE GRGDSVTKLHCDMSDAVNVL H A+
Sbjct: 568 QKSLKPDLGPKTYIAYGVVEELGRGDSVTKLHCDMSDAVNVLMHTAE 614


>tr|A7QF33|A7QF33_VITVI Chromosome chr16 scaffold_86, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00037256001
PE=4 SV=1
Length = 844

Score = 256 bits (653), Expect = 7e-67
Identities = 123/177 (69%), Positives = 142/177 (80%), Gaps = 1/177 (0%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGY 358
IVRNVL+KT GLSW+PMVMWRAFR TK E+ +VKAIDC DWCEV+INI QFF+GY
Sbjct: 314 IVRNVLEKTSGLSWDPMVMWRAFRGATKV-LKEDALSVKAIDCFDWCEVQINIFQFFKGY 372

Query: 357 AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLP 178
+ R H+ GWPEMLKLKDWPP+N F E LPRHGAEF++ LP+ DYT+P G+LNLATKLP
Sbjct: 373 LQGRRHKSGWPEMLKLKDWPPSNSFDECLPRHGAEFIAMLPYSDYTNPKSGLLNLATKLP 432

Query: 177 KNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMAD-TIPPSSSSL 10
++ KPDLGPKTYIAYG EE GRG+SVTKLHCD+SDAVNVLTH A I P S +
Sbjct: 433 -DVLKPDLGPKTYIAYGSLEELGRGNSVTKLHCDISDAVNVLTHTAKVNITPLQSKI 488


>tr|A5BYR6|A5BYR6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040756 PE=4 SV=1
Length = 2281

Score = 256 bits (653), Expect = 7e-67
Identities = 123/177 (69%), Positives = 142/177 (80%), Gaps = 1/177 (0%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGY 358
IVRNVL+KT GLSW+PMVMWRAFR TK E+ +VKAIDC DWCEV+INI QFF+GY
Sbjct: 1380 IVRNVLEKTSGLSWDPMVMWRAFRGATKV-LKEDALSVKAIDCFDWCEVQINIFQFFKGY 1438

Query: 357 AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLP 178
+ R H+ GWPEMLKLKDWPP+N F E LPRHGAEF++ LP+ DYT+P G+LNLATKLP
Sbjct: 1439 LQGRRHKSGWPEMLKLKDWPPSNSFDECLPRHGAEFIAMLPYSDYTNPKSGLLNLATKLP 1498

Query: 177 KNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMAD-TIPPSSSSL 10
++ KPDLGPKTYIAYG EE GRG+SVTKLHCD+SDAVNVLTH A I P S +
Sbjct: 1499 -DVLKPDLGPKTYIAYGSLEELGRGNSVTKLHCDISDAVNVLTHTAKVNIAPLQSKI 1554


>tr|O04698|O04698_PEA Chloroplast DNA-binding protein PD3 OS=Pisum
sativum PE=2 SV=1
Length = 1629

Score = 252 bits (644), Expect = 8e-66
Identities = 119/171 (69%), Positives = 132/171 (77%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGY 358
IVRNV K GLSW+PMVMWRAF K E+ KAIDCLDWCEVEIN QFF+GY
Sbjct: 1107 IVRNVYKKASGLSWDPMVMWRAFMGARKI-LKEDAVNFKAIDCLDWCEVEINAFQFFKGY 1165

Query: 357 AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLP 178
E R +R GWP MLKLKDWPP+NFF E LPRHGAEF++ LPF DYTHP G+LNLATKLP
Sbjct: 1166 LEGRRYRNGWPAMLKLKDWPPSNFFEECLPRHGAEFIAMLPFSDYTHPKSGILNLATKLP 1225

Query: 177 KNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMADTIPP 25
+ KPDLGPKTYIAYG +E RGDSVTKLHCD+SDAVN+LTH A+ PP
Sbjct: 1226 A-VLKPDLGPKTYIAYGTSDELSRGDSVTKLHCDISDAVNILTHTAEVKPP 1275


>tr|O82022|O82022_MEDTR ENBP1 protein OS=Medicago truncatula GN=ENBP1
PE=4 SV=1
Length = 1701

Score = 251 bits (640), Expect = 2e-65
Identities = 120/175 (68%), Positives = 133/175 (76%)
Frame = -3

Query: 537 IVRNVLDKTKGLSWEPMVMWRAFRETTKYKFAEETKTVKAIDCLDWCEVEINIRQFFRGY 358
IVRNV K GLSW+PMVMWRAFR K +E T KAIDCLDWCEV++N QFF+GY
Sbjct: 1174 IVRNVYKKGSGLSWDPMVMWRAFR-LAKNILKDEADTFKAIDCLDWCEVQVNAFQFFKGY 1232

Query: 357 AEDRMHRGGWPEMLKLKDWPPANFFHERLPRHGAEFVSALPFHDYTHPTRGMLNLATKLP 178
R +R GWPEMLKLKDWPP NFF + LPRHGAEF + LPF DYTHP G+LNLATKLP
Sbjct: 1233 LTGRRYRNGWPEMLKLKDWPPTNFFEDCLPRHGAEFTAMLPFSDYTHPKSGILNLATKLP 1292

Query: 177 KNIAKPDLGPKTYIAYGYEEEFGRGDSVTKLHCDMSDAVNVLTHMADTIPPSSSS 13
+ KPDLGPKTYIAYG EE RGDSVTKLHCD+SDAVN+LTH AD P+ S
Sbjct: 1293 -TVLKPDLGPKTYIAYGALEELSRGDSVTKLHCDISDAVNILTHTADVKTPAWQS 1346