BP913593
Clone id YMU001_000032_A02
Library
Length 666
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000032_A02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGATATTACCTGCAGGTACTCGTGATCACACGAGCTGGGGCTAGTTCTACGTGGCTTCT
GGTTAGTTCCTTCTTATTTTGCATTATCAAGACATTGGGCTACAAAATGTCCATAACTTC
AATAGGTTTAGCATTTGAAGTTTCTCTTTCCAAAAATAGCTCTTTTTAAAAGTAGCTCTA
CCCCTGTCCTTGGCTATTGTATCCTTGATACCTTCCTCTATTAGTTCCAGAACTTATATT
GGCTTCATTATCTTTGGAGCCGTCTACTCCATCTATATTCACCATTTCTAGATTGGTTAA
TGCAATCATTGACATTTCTTTACACTTATTGAAATGGTGACTTCTTATCCCACAATTGTT
CTAGACTTGTTCATAGGCCTTACAATACATACATTGGGCACATACATCTAACCTTGATCC
TTGGATTTATAGTTTGAGCACCAAGTCCCCAACTTTCCCATTGAGGTTCTGCTTTTAGCC
ATTTTAGCTATTTGTCTTCATGTTTCCTCTAGCTTCCTTTGTCCATGACCCTTTCTTTTT
GCCTTTAACTCTATCCTCTGAATCAATGCTAAATGAACTAGACCTAGAGCATGATTCAAA
CCCCTCAATTGACATGTCAGTGTTGATGGAGTCTCTTCGATTCCACTCTTATGGCCCTTC
CCCATT
■■Homology search results ■■ -
sp_hit_id A4WEY3
Definition sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638)
Align length 46
Score (bit) 31.2
E-value 5.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913593|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_A02.
(666 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Entero... 31 5.2
sp|Q2NQ94|RSMG_SODGM Ribosomal RNA small subunit methyltransfera... 31 6.7
sp|Q6BW42|ALG10_DEBHA Alpha-1,2 glucosyltransferase ALG10 OS=Deb... 31 6.7
sp|Q99102|MUC4_HUMAN Mucin-4 OS=Homo sapiens GN=MUC4 PE=1 SV=2 30 8.8

>sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2
OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1
Length = 898

Score = 31.2 bits (69), Expect = 5.2
Identities = 17/46 (36%), Positives = 26/46 (56%)
Frame = -2

Query: 551 ELKAKRKGHGQRKLEET*RQIAKMAKSRTSMGKLGTWCSNYKSKDQ 414
ELK K + +RKLEE R++A+ A+ R + G W K+K +
Sbjct: 184 ELKRKAEEEARRKLEEDARRVAEEAR-RMAEENAGVWAEQEKAKGE 228


>sp|Q2NQ94|RSMG_SODGM Ribosomal RNA small subunit methyltransferase
G OS=Sodalis glossinidius (strain morsitans) GN=rsmG
PE=3 SV=1
Length = 206

Score = 30.8 bits (68), Expect = 6.7
Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
Frame = -2

Query: 614 CQLRGLNHALGLVHLALIQ-RIELKAKRKGHGQRKLEET*RQIAKMAKSRTSMGKLGTWC 438
C LR + H LGL ++ +Q R+E A G ++++ S+G + TWC
Sbjct: 103 CFLRQVQHELGLDNITAVQSRVESFAPPAGFD-----------GVISRAFASLGDMLTWC 151

Query: 437 SNYKSKDQG*MY 402
+ K++G Y
Sbjct: 152 AALPRKEEGRFY 163


>sp|Q6BW42|ALG10_DEBHA Alpha-1,2 glucosyltransferase ALG10
OS=Debaryomyces hansenii GN=ALG10 PE=3 SV=1
Length = 461

Score = 30.8 bits (68), Expect = 6.7
Identities = 22/75 (29%), Positives = 36/75 (48%)
Frame = +3

Query: 195 YCILDTFLY*FQNLYWLHYLWSRLLHLYSPFLDWLMQSLTFLYTY*NGDFLSHNCSRLVH 374
Y ++ FL N ++ Y+W R+L+ + + M + T+ D LSHN L
Sbjct: 317 YTVVHPFLL-ADNRHYTFYIWKRILN--REYSNIFMIPIYHFCTWNIIDSLSHNIGGLTP 373

Query: 375 RPYNTYIGHIHLTLI 419
T+IG I +T+I
Sbjct: 374 ITIITFIGGIFITII 388


>sp|Q99102|MUC4_HUMAN Mucin-4 OS=Homo sapiens GN=MUC4 PE=1 SV=2
Length = 2169

Score = 30.4 bits (67), Expect = 8.8
Identities = 9/14 (64%), Positives = 13/14 (92%)
Frame = -3

Query: 487 LKWLKAEPQWESWG 446
L+WLK++P+W SWG
Sbjct: 1319 LQWLKSQPRWPSWG 1332


tr_hit_id Q04DS8
Definition tr|Q04DS8|Q04DS8_OENOB Predicted membrane protein OS=Oenococcus oeni (strain BAA-331 / PSU-1)
Align length 71
Score (bit) 33.9
E-value 9.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913593|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_A02.
(666 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q04DS8|Q04DS8_OENOB Predicted membrane protein OS=Oenococcus ... 34 9.4
tr|Q7REH9|Q7REH9_PLAYO Putative uncharacterized protein PY05085 ... 34 9.4

>tr|Q04DS8|Q04DS8_OENOB Predicted membrane protein OS=Oenococcus
oeni (strain BAA-331 / PSU-1) GN=OEOE_1537 PE=4 SV=1
Length = 225

Score = 33.9 bits (76), Expect = 9.4
Identities = 21/71 (29%), Positives = 37/71 (52%)
Frame = +1

Query: 160 LFLKVALPLSLAIVSLIPSSISSRTYIGFIIFGAVYSIYIHHF*IG*CNH*HFFTLIEMV 339
LFL + L+ I + I+ R IG +IFG ++S+++ F I F L+ +
Sbjct: 61 LFLAIEAILAAVINLFMVEKINWRRAIGNVIFGLLFSLFVAEFAI------LFHPLLAPL 114

Query: 340 TSYPTIVLDLF 372
+ P +++DLF
Sbjct: 115 SLIPKLIVDLF 125


>tr|Q7REH9|Q7REH9_PLAYO Putative uncharacterized protein PY05085
(Fragment) OS=Plasmodium yoelii yoelii GN=PY05085 PE=4
SV=1
Length = 1811

Score = 33.9 bits (76), Expect = 9.4
Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 5/122 (4%)
Frame = -1

Query: 549 VKGKKKGSWTKEARGNMKTNS*NG*KQ-----NLNGKVGDLVLKL*IQGSRLDVCAQCMY 385
+ K K W +G M N K+ +LN + + + ++ + R +C Q +Y
Sbjct: 682 INNKIKELWCGRVKGLMNVKLCNMEKKIANEFSLNNIIKNNIHEVTLDYERSAMCYQDLY 741

Query: 384 CKAYEQV*NNCGIRSHHFNKCKEMSMIALTNLEMVNIDGVDGSKDNEANISSGTNRGRYQ 205
+ Y G+ S K++ MI N NIDGV S++NE++ + + +
Sbjct: 742 AQLYV-----IGLNS------KKIEMIKKINEFKNNIDGVANSQENESDAKKKKDSSKKK 790

Query: 204 GY 199
GY
Sbjct: 791 GY 792