BP913613
Clone id YMU001_000032_C01
Library
Length 507
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000032_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTATACAGAAAACCGTGAGAATTCCCGGAGCCCATAGAGGAAATTCCTTCAGCTTTACAA
TTGAATGCACGTAGATGTATACACCATAGTATGCAGCACGTCAGTGTAGACCACCTTAGT
TTAGGTCAGCATGTACAAATCAATGTGCACAAACTGCAGGCTTAACAAAGCTATACATAA
CAAAAGAGTTCACATGACTCGATCAAGGGTCTGCATGACCAGCCACCTCCTCTTCGCTTG
ACATGTACACATCATCATCACTCGTTTCTCCTTCACTGCTCTCGTCTTCAGCCTTGTTGT
TGTCCTCTGGCTTGGCATATTTCTCGCAATATTCTCTCACTTTCTTTCCATATTGCTCGC
GATCCCGCATCATCAATGTAGCCGTTTCTCCATTCAGTGGATCAGTGGGATTAGGGTACA
AGAGTAATTGTGGAAGGAAAACTTCAAAAACATTCACAAGCTCAGACATTGGACTCCAAG
TTTGATTTATCACATCCAGGCAAACTG
■■Homology search results ■■ -
sp_hit_id P16577
Definition sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa OS=Triticum aestivum
Align length 101
Score (bit) 131.0
E-value 2.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913613|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_C01.
(507 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa OS=T... 131 2e-30
sp|P42750|UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabid... 120 3e-27
sp|P42748|UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabid... 120 4e-27
sp|P42749|UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabid... 119 6e-27
sp|Q9P7R4|UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8 OS=Schizo... 100 5e-21
sp|P62257|UBE2H_MOUSE Ubiquitin-conjugating enzyme E2 H OS=Mus m... 92 2e-18
sp|P62256|UBE2H_HUMAN Ubiquitin-conjugating enzyme E2 H OS=Homo ... 92 2e-18
sp|Q32LN1|UBE2H_BOVIN Ubiquitin-conjugating enzyme E2 H OS=Bos t... 92 2e-18
sp|P28263|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=S... 85 2e-16
sp|P70711|U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattu... 54 4e-07
sp|Q6ZWY6|U2D2B_MOUSE Ubiquitin-conjugating enzyme E2 D2B OS=Mus... 54 4e-07
sp|P35129|UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenor... 54 5e-07
sp|P62840|UB2D2_XENLA Ubiquitin-conjugating enzyme E2 D2 OS=Xeno... 54 5e-07
sp|P62839|UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus... 54 5e-07
sp|P62838|UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus ... 54 5e-07
sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo... 54 5e-07
sp|Q1RMX2|UB2D2_BOVIN Ubiquitin-conjugating enzyme E2 D2 OS=Bos ... 54 5e-07
sp|P25867|UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=... 53 9e-07
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo... 52 2e-06
sp|P61078|UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus... 52 2e-06
sp|Q5R4V7|UB2D3_PONAB Ubiquitin-conjugating enzyme E2 D3 OS=Pong... 52 2e-06
sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus ... 52 2e-06
sp|Q4R5N4|UB2D3_MACFA Ubiquitin-conjugating enzyme E2 D3 OS=Maca... 52 2e-06
sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo... 52 2e-06
sp|Q3ZCF7|UB2D3_BOVIN Ubiquitin-conjugating enzyme E2 D3 OS=Bos ... 52 2e-06
sp|Q06AA9|UB2D2_PIG Ubiquitin-conjugating enzyme E2 D2 OS=Sus sc... 52 2e-06
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus ... 52 2e-06
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo... 52 2e-06
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos ... 52 2e-06
sp|Q553F3|UBC2_DICDI Ubiquitin-conjugating enzyme E2 2 OS=Dictyo... 51 3e-06

>sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa
OS=Triticum aestivum GN=UBC4 PE=1 SV=1
Length = 184

Score = 131 bits (329), Expect = 2e-30
Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 1/101 (0%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVN+FEVFLPQLLLYPNP+DPLNGE A+LMMRD+ Y KV+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYC 143

Query: 325 EKYAKPED-NNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
E+YAKPED + + + Y S +E + GHADP
Sbjct: 144 ERYAKPEDISPEEEEEESDEELSDAEGYDSGDEAIMGHADP 184


>sp|P42750|UBC6_ARATH Ubiquitin-conjugating enzyme E2 6
OS=Arabidopsis thaliana GN=UBC6 PE=2 SV=2
Length = 183

Score = 120 bits (302), Expect = 3e-27
Identities = 59/100 (59%), Positives = 69/100 (69%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +L+NVFE FLPQLLLYPNP+DP NGE A+L+MRDR Y KV+EYC
Sbjct: 84 VCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPE+ D ++E+ G ADP
Sbjct: 144 EKYAKPEEILSDDDDDDSMSEDGSDSDDDDDDEIVGKADP 183


>sp|P42748|UBC4_ARATH Ubiquitin-conjugating enzyme E2 4
OS=Arabidopsis thaliana GN=UBC4 PE=2 SV=2
Length = 187

Score = 120 bits (301), Expect = 4e-27
Identities = 54/71 (76%), Positives = 62/71 (87%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFE FLPQLLLYPNP+DPLNGE A LMMRDR Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYC 143

Query: 325 EKYAKPEDNNK 293
EKYAKP + ++
Sbjct: 144 EKYAKPGEGSE 154


>sp|P42749|UBC5_ARATH Ubiquitin-conjugating enzyme E2 5
OS=Arabidopsis thaliana GN=UBC5 PE=2 SV=2
Length = 185

Score = 119 bits (299), Expect = 6e-27
Identities = 54/66 (81%), Positives = 59/66 (89%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFE FLPQLLLYPNP+DPLNGE A LMMRDR Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYC 143

Query: 325 EKYAKP 308
EKYAKP
Sbjct: 144 EKYAKP 149


>sp|Q9P7R4|UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8
OS=Schizosaccharomyces pombe GN=ubc8 PE=2 SV=1
Length = 184

Score = 100 bits (248), Expect = 5e-21
Identities = 44/68 (64%), Positives = 54/68 (79%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +++N+FEVFLPQLL YPN +DPLNGE A L++R+ Y KVR+Y
Sbjct: 84 VCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPLNGEAAALLLREPNTYYAKVRDYI 143

Query: 325 EKYAKPED 302
+YA ED
Sbjct: 144 ARYANKED 151


>sp|P62257|UBE2H_MOUSE Ubiquitin-conjugating enzyme E2 H OS=Mus
musculus GN=Ube2h PE=2 SV=1
Length = 183

Score = 91.7 bits (226), Expect = 2e-18
Identities = 39/67 (58%), Positives = 51/67 (76%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTW+ + +L N+FE FLPQLL YPNP DPLNG+ A + + E+Y +K++EY
Sbjct: 86 VCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYI 145

Query: 325 EKYAKPE 305
+KYA E
Sbjct: 146 QKYATEE 152


>sp|P62256|UBE2H_HUMAN Ubiquitin-conjugating enzyme E2 H OS=Homo
sapiens GN=UBE2H PE=1 SV=1
Length = 183

Score = 91.7 bits (226), Expect = 2e-18
Identities = 39/67 (58%), Positives = 51/67 (76%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTW+ + +L N+FE FLPQLL YPNP DPLNG+ A + + E+Y +K++EY
Sbjct: 86 VCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYI 145

Query: 325 EKYAKPE 305
+KYA E
Sbjct: 146 QKYATEE 152


>sp|Q32LN1|UBE2H_BOVIN Ubiquitin-conjugating enzyme E2 H OS=Bos
taurus GN=UBE2H PE=2 SV=1
Length = 183

Score = 91.7 bits (226), Expect = 2e-18
Identities = 39/67 (58%), Positives = 51/67 (76%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTW+ + +L N+FE FLPQLL YPNP DPLNG+ A + + E+Y +K++EY
Sbjct: 86 VCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYI 145

Query: 325 EKYAKPE 305
+KYA E
Sbjct: 146 QKYATEE 152


>sp|P28263|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa
OS=Saccharomyces cerevisiae GN=UBC8 PE=1 SV=2
Length = 218

Score = 84.7 bits (208), Expect = 2e-16
Identities = 36/67 (53%), Positives = 50/67 (74%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
+CLDVIN TWSP+ +L+N+ E +P LL PN +DPLN E ATL +RD++ Y +K++EY
Sbjct: 84 ICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYI 143

Query: 325 EKYAKPE 305
+KYA E
Sbjct: 144 DKYATKE 150


>sp|P70711|U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus
norvegicus GN=Ube2d2b PE=2 SV=1
Length = 147

Score = 53.9 bits (128), Expect = 4e-07
Identities = 25/64 (39%), Positives = 37/64 (57%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
+CLD++ WSP + V + + LL PNP DPL E A + DR++Y + RE+
Sbjct: 84 ICLDILRSQWSPALTISKVL-LSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWT 142

Query: 325 EKYA 314
+KYA
Sbjct: 143 QKYA 146


tr_hit_id A9NT18
Definition tr|A9NT18|A9NT18_PICSI Ubiquitin carrier protein OS=Picea sitchensis
Align length 100
Score (bit) 142.0
E-value 7.0e-33
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913613|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_C01.
(507 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NT18|A9NT18_PICSI Ubiquitin carrier protein OS=Picea sitche... 142 7e-33
tr|A9RZ99|A9RZ99_PHYPA Ubiquitin carrier protein OS=Physcomitrel... 141 2e-32
tr|Q9SPB9|Q9SPB9_SOYBN Ubiquitin carrier protein OS=Glycine max ... 139 8e-32
tr|A9T424|A9T424_PHYPA Ubiquitin carrier protein OS=Physcomitrel... 138 1e-31
tr|A5AU32|A5AU32_VITVI Ubiquitin carrier protein OS=Vitis vinife... 136 5e-31
tr|A9NKH9|A9NKH9_PICSI Ubiquitin carrier protein OS=Picea sitche... 136 7e-31
tr|A9PK42|A9PK42_POPJC Ubiquitin carrier protein OS=Populus jack... 135 1e-30
tr|A5B1R0|A5B1R0_VITVI Ubiquitin carrier protein OS=Vitis vinife... 133 4e-30
tr|A9PG85|A9PG85_POPTR Putative uncharacterized protein OS=Popul... 130 5e-29
tr|B6SIN0|B6SIN0_MAIZE Ubiquitin-conjugating enzyme E2-21 kDa 1 ... 128 2e-28
tr|B6SHP3|B6SHP3_MAIZE Ubiquitin-conjugating enzyme E2-21 kDa 1 ... 128 2e-28
tr|Q337R4|Q337R4_ORYSJ Ubiquitin carrier protein OS=Oryza sativa... 127 2e-28
tr|B8BH65|B8BH65_ORYSI Putative uncharacterized protein OS=Oryza... 127 2e-28
tr|B6UHU0|B6UHU0_MAIZE Ubiquitin-conjugating enzyme E2-21 kDa 1 ... 127 3e-28
tr|B4FIK1|B4FIK1_MAIZE Putative uncharacterized protein OS=Zea m... 126 5e-28
tr|B4FFL4|B4FFL4_MAIZE Putative uncharacterized protein OS=Zea m... 126 7e-28
tr|A7PD43|A7PD43_VITVI Ubiquitin carrier protein OS=Vitis vinife... 125 9e-28
tr|B6SZ42|B6SZ42_MAIZE Ubiquitin-conjugating enzyme E2-21 kDa 1 ... 124 3e-27
tr|A9PH51|A9PH51_POPTR Ubiquitin carrier protein OS=Populus tric... 124 3e-27
tr|A3C590|A3C590_ORYSJ Ubiquitin carrier protein OS=Oryza sativa... 120 5e-26
tr|B8LMU5|B8LMU5_PICSI Putative uncharacterized protein OS=Picea... 117 2e-25
tr|Q5KAU2|Q5KAU2_CRYNE Ubiquitin carrier protein OS=Cryptococcus... 110 3e-23
tr|Q55KN2|Q55KN2_CRYNE Ubiquitin carrier protein OS=Cryptococcus... 110 3e-23
tr|A8HQ87|A8HQ87_CHLRE Ubiquitin carrier protein OS=Chlamydomona... 110 4e-23
tr|A7EAE7|A7EAE7_SCLS1 Ubiquitin carrier protein OS=Sclerotinia ... 107 2e-22
tr|Q0UNM1|Q0UNM1_PHANO Ubiquitin carrier protein OS=Phaeosphaeri... 107 4e-22
tr|B2VWQ9|B2VWQ9_PYRTR Ubiquitin-conjugating enzyme E2 H OS=Pyre... 107 4e-22
tr|B2ARH9|B2ARH9_PODAN Predicted CDS Pa_4_7440 OS=Podospora anse... 106 6e-22
tr|Q54VW9|Q54VW9_DICDI Ubiquitin carrier protein OS=Dictyosteliu... 106 7e-22
tr|A4REQ4|A4REQ4_MAGGR Putative uncharacterized protein OS=Magna... 105 9e-22

>tr|A9NT18|A9NT18_PICSI Ubiquitin carrier protein OS=Picea
sitchensis PE=2 SV=1
Length = 183

Score = 142 bits (359), Expect = 7e-33
Identities = 70/100 (70%), Positives = 77/100 (77%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPNPTDPLNGE A LMMRDR+ Y +KV+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPTDPLNGEAAALMMRDRQVYEQKVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
+YAKP+D K D Y SS+EEVAGHADP
Sbjct: 144 ARYAKPKDVGKQEEEESSDEEVSEDEYGSSDEEVAGHADP 183


>tr|A9RZ99|A9RZ99_PHYPA Ubiquitin carrier protein OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_161932 PE=3 SV=1
Length = 183

Score = 141 bits (356), Expect = 2e-32
Identities = 68/100 (68%), Positives = 77/100 (77%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +L+NVFEVFLPQLLLYPNPTDPLNGE A LMMRDRE Y +KV+EYC
Sbjct: 84 VCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPTDPLNGEAAALMMRDREHYEQKVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
E+YAK ED + + MSS+EE+AGHADP
Sbjct: 144 ERYAKAEDIGRHPEDSSDDELSEEEDCMSSDEEMAGHADP 183


>tr|Q9SPB9|Q9SPB9_SOYBN Ubiquitin carrier protein OS=Glycine max
GN=UBC4 PE=2 SV=1
Length = 183

Score = 139 bits (350), Expect = 8e-32
Identities = 69/100 (69%), Positives = 76/100 (76%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPNP+DPLNGE A LMMRDR Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPED A D Y SS+E+VAG ADP
Sbjct: 144 EKYAKPEDIGAATEENSSDEELTEDEYDSSDEQVAGKADP 183


>tr|A9T424|A9T424_PHYPA Ubiquitin carrier protein OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_107441 PE=3 SV=1
Length = 159

Score = 138 bits (348), Expect = 1e-31
Identities = 68/101 (67%), Positives = 77/101 (76%), Gaps = 1/101 (0%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +L+NVFEVFLPQLLLYPNPTDPLNGE A LMMRDRE Y +KV+EYC
Sbjct: 59 VCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPTDPLNGEAAALMMRDREHYEQKVKEYC 118

Query: 325 EKYAKPED-NNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
E+YAK ED + + MSS+EE+AGHADP
Sbjct: 119 ERYAKAEDIGRRPEEESSDEELSDEEDCMSSDEEMAGHADP 159


>tr|A5AU32|A5AU32_VITVI Ubiquitin carrier protein OS=Vitis vinifera
GN=GSVIVT00002573001 PE=3 SV=1
Length = 183

Score = 136 bits (343), Expect = 5e-31
Identities = 68/100 (68%), Positives = 75/100 (75%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPNP+DPLNGE A LMMRDR Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPE+ A D Y SS+E VAG ADP
Sbjct: 144 EKYAKPENIGAAPEEKSSDEELSEDNYESSDEAVAGQADP 183


>tr|A9NKH9|A9NKH9_PICSI Ubiquitin carrier protein OS=Picea
sitchensis PE=2 SV=1
Length = 183

Score = 136 bits (342), Expect = 7e-31
Identities = 66/100 (66%), Positives = 77/100 (77%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFE FLPQLLLYPNPTDPLNG+ A+LMMRDREQY +KV+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFESFLPQLLLYPNPTDPLNGDAASLMMRDREQYEQKVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
E+YA+ E+ + D SS++EVAGHADP
Sbjct: 144 ERYARGENGSNCPEESSDDEEVSDDDSESSDDEVAGHADP 183


>tr|A9PK42|A9PK42_POPJC Ubiquitin carrier protein OS=Populus jackii
PE=2 SV=1
Length = 183

Score = 135 bits (340), Expect = 1e-30
Identities = 66/100 (66%), Positives = 75/100 (75%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPNP+DPLNGE A LMMRD+ Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDKPAYEQRVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPED A D Y S ++E+AG ADP
Sbjct: 144 EKYAKPEDIGAAPEEKSSDEELSEDEYESLDDEMAGQADP 183


>tr|A5B1R0|A5B1R0_VITVI Ubiquitin carrier protein OS=Vitis vinifera
GN=GSVIVT00026892001 PE=3 SV=1
Length = 184

Score = 133 bits (335), Expect = 4e-30
Identities = 69/101 (68%), Positives = 75/101 (74%), Gaps = 1/101 (0%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPNP+DPLNGE A LMMRDR Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYC 143

Query: 325 EKYAKPEDNNKA-XXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPED A D Y SS+E VAG ADP
Sbjct: 144 EKYAKPEDVGAAPEEKSSDEEELSEDDYDSSDEAVAGQADP 184


>tr|A9PG85|A9PG85_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 183

Score = 130 bits (326), Expect = 5e-29
Identities = 64/100 (64%), Positives = 72/100 (72%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPN +DPLNGE A LMMRD Y ++V+EYC
Sbjct: 84 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNGEAAALMMRDHTAYDQRVKEYC 143

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPED D Y S +++VAG ADP
Sbjct: 144 EKYAKPEDIGAKPEEKSSDEELSEDDYNSDDDQVAGKADP 183


>tr|B6SIN0|B6SIN0_MAIZE Ubiquitin-conjugating enzyme E2-21 kDa 1
OS=Zea mays PE=2 SV=1
Length = 174

Score = 128 bits (321), Expect = 2e-28
Identities = 63/100 (63%), Positives = 71/100 (71%)
Frame = -3

Query: 505 VCLDVINQTWSPMSELVNVFEVFLPQLLLYPNPTDPLNGETATLMMRDREQYGKKVREYC 326
VCLDVINQTWSPM +LVNVFEVFLPQLLLYPNP+DPLNGE A LMMRDR Y +KV+EYC
Sbjct: 75 VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYC 134

Query: 325 EKYAKPEDNNKAXXXXXXXXXXXXDVYMSSEEEVAGHADP 206
EKYAKPED + S +E + G+ DP
Sbjct: 135 EKYAKPEDAGITPEDKSSDEELSEEEDDSGDEAILGNPDP 174