BP913629
Clone id YMU001_000032_D09
Library
Length 582
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000032_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GATATTACCTGCAGGTACTCAGGACCTTGTGATTCTTCTTCTCGATTTTGAGAAGGCATA
CAACAGAGTTGACTGGGACTTTTTAGAGGGCACGCTACGCAGGATGGGCTTCTCAGATGC
TTGGATCAGAGGGATGTCAGCTTGGTACAGACAGGCTCATAGTCAGGTGCTTTTGGCAGG
AGGTAGAGGTGAGCGCTTCATGCTCACACGATCGGTCAGACAGGGTTGTCCTCTTGCCCC
CTTTCTCTTTTTGTTCTATGCGGAGGCGATGAGCAGATTTTTGGTGTCATAGCAGGTTGG
TCTGAGAGGCTTAGGTCTGAGAGGCTTAGCACTCCCTATACGGGGAGATGAGCTTCTGGA
CGCTGAGTTTGCCGACGACTCAGCCTTGTACTTAGAGGGCCAGGAGGCCAATTTACACAG
ATGTGAGCAGGCTCTGGAGACCTTCTGTTGTGCATCGGGCGCACCGATCAACTGGAGAAA
GACAGTGGCTTTCTCGGTTGGCAGTGCTCCTGTGCCAGATTGGATGCCAGGAGAGGGTTT
CAGGTGGATTCCTCCAGGGACTGCAGTTAGGTACTTGGGTTG
■■Homology search results ■■ -
sp_hit_id P08548
Definition sp|P08548|LIN1_NYCCO LINE-1 reverse transcriptase homolog OS=Nycticebus coucang
Align length 158
Score (bit) 70.1
E-value 8.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913629|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_D09.
(582 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P08548|LIN1_NYCCO LINE-1 reverse transcriptase homolog OS=Nyc... 70 8e-12
sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa prot... 62 2e-09
sp|P11369|POL2_MOUSE Retrovirus-related Pol polyprotein LINE-1 O... 58 4e-08
sp|Q03278|PO21_NASVI Retrovirus-related Pol polyprotein from typ... 40 0.006
sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from typ... 38 0.032
sp|P16423|POLR_DROME Retrovirus-related Pol polyprotein from typ... 38 0.042
sp|Q05118|PO23_POPJA Retrovirus-related Pol polyprotein from typ... 37 0.093
sp|P50535|MSL1_DROME Protein male-specific lethal-1 OS=Drosophil... 31 5.2
sp|Q4UMI6|RICKA_RICFE Arp2/3 complex-activating protein rickA OS... 30 6.7
sp|O35674|ADA19_MOUSE ADAM 19 OS=Mus musculus GN=Adam19 PE=2 SV=2 30 6.7
sp|Q96AP4|ZUFSP_HUMAN Zinc finger with UFM1-specific peptidase d... 30 8.7
sp|P34620|YO84_CAEEL Putative uncharacterized transposon-derived... 30 8.7

>sp|P08548|LIN1_NYCCO LINE-1 reverse transcriptase homolog
OS=Nycticebus coucang PE=1 SV=1
Length = 1260

Score = 70.1 bits (170), Expect = 8e-12
Identities = 43/158 (27%), Positives = 77/158 (48%)
Frame = +2

Query: 20 QDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGERF 199
+D +IL +D EKA++ + F+ TL+++G +++ + A Y + + ++L G + + F
Sbjct: 591 KDHMILSIDAEKAFDNIQHPFMIRTLKKIGIEGTFLKLIEAIYSKPTANIILNGVKLKSF 650

Query: 200 MLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFADD 379
L RQGCPL+P LF E ++ +E+ + FADD
Sbjct: 651 PLRSGTRQGCPLSPLLFNIVMEVLA--------IAIREEKAIKGIHIGSEEIKLSLFADD 702

Query: 380 SALYLEGQEANLHRCEQALETFCCASGAPINWRKTVAF 493
+YLE + + + ++ + SG IN K+VAF
Sbjct: 703 MIVYLENTRDSTTKLLEVIKEYSNVSGYKINTHKSVAF 740


>sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa protein
OS=Xenopus laevis PE=4 SV=1
Length = 1308

Score = 62.4 bits (150), Expect = 2e-09
Identities = 56/186 (30%), Positives = 81/186 (43%), Gaps = 1/186 (0%)
Frame = +2

Query: 26 LVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGERFML 205
L L LD EKA++RVD +L GTL+ F ++ + Y A V +
Sbjct: 588 LAFLSLDQEKAFDRVDHQYLIGTLQAYSFGPQFVGYLKTMYASAECLVKINWSLTAPLAF 647

Query: 206 TRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFADDSA 385
R VRQGCPL+ L Y+ A+ FL ++ + +ADD
Sbjct: 648 GRGVRQGCPLSGQL---YSLAIEPFL-----CLLRKRLTGLVLKEPDMRVVLSAYADDVI 699

Query: 386 LYLEGQEANLHRCEQALETFCCASGAPINWRKTVAFSVGSAPVPDWMPGEGFRWIP-PGT 562
L + +L R ++ E + AS A INW K+ GS V D++P FR I
Sbjct: 700 LVAQ-DLVDLERAQECQEVYAAASSARINWSKSSGLLEGSLKV-DFLP-PAFRDISWESK 756

Query: 563 AVRYLG 580
++YLG
Sbjct: 757 IIKYLG 762


>sp|P11369|POL2_MOUSE Retrovirus-related Pol polyprotein LINE-1 OS=Mus
musculus GN=Pol PE=2 SV=2
Length = 1281

Score = 57.8 bits (138), Expect = 4e-08
Identities = 38/155 (24%), Positives = 69/155 (44%)
Frame = +2

Query: 29 VILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGERFMLT 208
+I+ LD EKA++++ F+ L R G ++ + A Y + + + + G + E L
Sbjct: 602 MIISLDAEKAFDKIQHPFMIKVLERSGIQGPYLNMIKAIYSKPVANIKVNGEKLEAIPLK 661

Query: 209 RSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFADDSAL 388
RQGCPL+P+LF E ++R + +E+ + ADD +
Sbjct: 662 SGTRQGCPLSPYLFNIVLEVLARAI--------RQQKEIKGIQIGKEEVKISLLADDMIV 713

Query: 389 YLEGQEANLHRCEQALETFCCASGAPINWRKTVAF 493
Y+ + + + +F G IN K++AF
Sbjct: 714 YISDPKNSTRELLNLINSFGEVVGYKINSNKSMAF 748


>sp|Q03278|PO21_NASVI Retrovirus-related Pol polyprotein from type-1
retrotransposable element R2 (Fragment) OS=Nasonia
vitripennis PE=4 SV=2
Length = 1025

Score = 40.4 bits (93), Expect = 0.006
Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 4/142 (2%)
Frame = +2

Query: 26 LVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAW-YRQAHSQVLLAGGRGERFM 202
L I +LD +KA++ V+ + LRR +R W YR + +++ + +G
Sbjct: 450 LYIAILDVKKAFDSVEHRSILDALRRKKLP-LEMRNYIMWVYRNSKTRLEVVKTKGRWIR 508

Query: 203 LTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFADDS 382
R VRQG PL+P LF +A+ R L +++ FADD
Sbjct: 509 PARGVRQGDPLSPLLFNCVMDAVLRRL-----------PENTGFLMGAEKIGALVFADDL 557

Query: 383 ALYL---EGQEANLHRCEQALE 439
L EG +A+L R E L+
Sbjct: 558 VLLAETREGLQASLSRIEAGLQ 579


>sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from type-1
retrotransposable element R2 (Fragment) OS=Popillia
japonica PE=4 SV=1
Length = 711

Score = 38.1 bits (87), Expect = 0.032
Identities = 37/160 (23%), Positives = 68/160 (42%), Gaps = 1/160 (0%)
Frame = +2

Query: 32 ILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLA-GGRGERFMLT 208
++ LD KA++ V + L+R+G + ++ + + + + G + + +
Sbjct: 139 VVSLDVRKAFDTVSHSSICRALQRLGIDEGTSNYITGSLSDSTTTIRVGPGSQTRKICIR 198

Query: 209 RSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFADDSAL 388
R V+QG PL+PFLF + L S Q +++ FADD L
Sbjct: 199 RGVKQGDPLSPFLF---NAVLDELLCSLQ------STPGIGGTIGEEKIPVLAFADD-LL 248

Query: 389 YLEGQEANLHRCEQALETFCCASGAPINWRKTVAFSVGSA 508
LE + L + F G +N +K+V+ SV ++
Sbjct: 249 LLEDNDVLLPTTLATVANFFRLRGMSLNAKKSVSISVAAS 288


>sp|P16423|POLR_DROME Retrovirus-related Pol polyprotein from type-2
retrotransposable element R2DM OS=Drosophila
melanogaster GN=pol PE=4 SV=1
Length = 1057

Score = 37.7 bits (86), Expect = 0.042
Identities = 24/83 (28%), Positives = 38/83 (45%)
Frame = +2

Query: 41 LDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGERFMLTRSVR 220
LD KA++ + + TLR G ++ + Y + + G E F+ R V+
Sbjct: 481 LDVSKAFDSLSHASIYDTLRAYGAPKGFVDYVQNTYEGGGTSLNGDGWSSEEFVPARGVK 540

Query: 221 QGCPLAPFLFLFYAEAMSRFLVS 289
QG PL+P LF + + R L S
Sbjct: 541 QGDPLSPILFNLVMDRLLRTLPS 563


>sp|Q05118|PO23_POPJA Retrovirus-related Pol polyprotein from type-1
retrotransposable element R2 (Fragment) OS=Popillia
japonica PE=4 SV=1
Length = 606

Score = 36.6 bits (83), Expect = 0.093
Identities = 18/73 (24%), Positives = 35/73 (47%)
Frame = +2

Query: 32 ILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGERFMLTR 211
++ LD KA++ V + +R G D + + A++ +++ G + +
Sbjct: 25 VVSLDIRKAFDTVSHPAILRAMRAFGIDDGMQDFIMSTITDAYTNIVVGGRTTNKIYIRN 84

Query: 212 SVRQGCPLAPFLF 250
V+QG PL+P LF
Sbjct: 85 GVKQGDPLSPVLF 97


>sp|P50535|MSL1_DROME Protein male-specific lethal-1 OS=Drosophila
melanogaster GN=msl-1 PE=1 SV=2
Length = 1039

Score = 30.8 bits (68), Expect = 5.2
Identities = 12/33 (36%), Positives = 21/33 (63%)
Frame = -1

Query: 582 QPKYLTAVPGGIHLKPSPGIQSGTGALPTEKAT 484
QP++ A+P GI++K SP + GA+ + A+
Sbjct: 222 QPQFANALPRGINMKESPALDHHAGAVTNQPAS 254


>sp|Q4UMI6|RICKA_RICFE Arp2/3 complex-activating protein rickA
OS=Rickettsia felis GN=rickA PE=3 SV=2
Length = 526

Score = 30.4 bits (67), Expect = 6.7
Identities = 17/58 (29%), Positives = 26/58 (44%)
Frame = -2

Query: 530 LASNLAQEHCQPRKPLSFSS*SVRPMHNRRSPEPAHICVNWPPGPLSTRLSRRQTQRP 357
+ SNLA ++P+ +S +P+ N +P P N PP P LS+ P
Sbjct: 288 IVSNLANHMTSKKEPILTTSSIAKPLENNVTPPPPLTKNNIPPPPPPPPLSKNNILPP 345


>sp|O35674|ADA19_MOUSE ADAM 19 OS=Mus musculus GN=Adam19 PE=2 SV=2
Length = 920

Score = 30.4 bits (67), Expect = 6.7
Identities = 14/37 (37%), Positives = 18/37 (48%)
Frame = -2

Query: 461 RPMHNRRSPEPAHICVNWPPGPLSTRLSRRQTQRPEA 351
+P H P P ++ V PP PL L+R PEA
Sbjct: 787 KPSHPPPRPPPDYLRVESPPAPLPAHLNRAAGSSPEA 823


tr_hit_id Q7XLZ5
Definition tr|Q7XLZ5|Q7XLZ5_ORYSJ OSJNBa0086O06.14 protein OS=Oryza sativa subsp. japonica
Align length 152
Score (bit) 87.0
E-value 7.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913629|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_D09.
(582 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7XLZ5|Q7XLZ5_ORYSJ OSJNBa0086O06.14 protein OS=Oryza sativa ... 87 7e-16
tr|A3AWW8|A3AWW8_ORYSJ Putative uncharacterized protein OS=Oryza... 87 7e-16
tr|O82276|O82276_ARATH Putative non-LTR retroelement reverse tra... 86 1e-15
tr|Q53PH7|Q53PH7_ORYSJ Retrotransposon protein, putative, unclas... 84 6e-15
tr|Q2HS45|Q2HS45_MEDTR RNA-directed DNA polymerase (Reverse tran... 84 7e-15
tr|O22148|O22148_ARATH Putative non-LTR retroelement reverse tra... 84 7e-15
tr|Q2QWF4|Q2QWF4_ORYSJ Retrotransposon protein, putative, unclas... 83 1e-14
tr|A3CFR5|A3CFR5_ORYSJ Putative uncharacterized protein OS=Oryza... 83 1e-14
tr|Q84MQ3|Q84MQ3_ORYSJ Putative reverse transcriptase (Putative ... 83 1e-14
tr|A2XHV0|A2XHV0_ORYSI Putative uncharacterized protein OS=Oryza... 83 1e-14
tr|Q9FW98|Q9FW98_ORYSJ Putative non-LTR retroelement reverse tra... 82 2e-14
tr|Q7XCU0|Q7XCU0_ORYSJ Retrotransposon protein, putative, unclas... 82 2e-14
tr|A5AK79|A5AK79_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-14
tr|A3B6L1|A3B6L1_ORYSJ Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|Q9M1F2|Q9M1F2_ARATH Putative uncharacterized protein F9K21.13... 82 2e-14
tr|A3BTK9|A3BTK9_ORYSJ Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|Q9SIS9|Q9SIS9_ARATH Putative non-LTR retroelement reverse tra... 82 3e-14
tr|A5BSZ6|A5BSZ6_VITVI Putative uncharacterized protein OS=Vitis... 82 3e-14
tr|A5AD48|A5AD48_VITVI Putative uncharacterized protein OS=Vitis... 82 3e-14
tr|A5C4L0|A5C4L0_VITVI Putative uncharacterized protein OS=Vitis... 81 5e-14
tr|A5BR45|A5BR45_VITVI Putative uncharacterized protein OS=Vitis... 80 6e-14
tr|A5BA26|A5BA26_VITVI Putative uncharacterized protein OS=Vitis... 80 6e-14
tr|A5B0H6|A5B0H6_VITVI Putative uncharacterized protein OS=Vitis... 80 6e-14
tr|A5CAR7|A5CAR7_VITVI Putative uncharacterized protein OS=Vitis... 80 8e-14
tr|A5C9Z7|A5C9Z7_VITVI Putative uncharacterized protein OS=Vitis... 80 8e-14
tr|A5BPJ7|A5BPJ7_VITVI Putative uncharacterized protein OS=Vitis... 80 8e-14
tr|B8AWH5|B8AWH5_ORYSI Putative uncharacterized protein OS=Oryza... 80 1e-13
tr|A5C4A5|A5C4A5_VITVI Putative uncharacterized protein OS=Vitis... 80 1e-13
tr|A5BHN0|A5BHN0_VITVI Putative uncharacterized protein OS=Vitis... 80 1e-13
tr|A5B034|A5B034_VITVI Putative uncharacterized protein OS=Vitis... 80 1e-13

>tr|Q7XLZ5|Q7XLZ5_ORYSJ OSJNBa0086O06.14 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0086O06.14 PE=4 SV=2
Length = 1205

Score = 87.0 bits (214), Expect = 7e-16
Identities = 52/152 (34%), Positives = 76/152 (50%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+QD L LD KAY+RVDW FL+G L+++GF + W + + + V L G E
Sbjct: 555 SQDFCALKLDLSKAYDRVDWGFLDGALQKLGFGNIWRKWIMSCVTSVRYSVRLNGNMLEP 614

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
F TR +R+G PL P+LFLF A+ +S L + LL FAD
Sbjct: 615 FYPTRGLREGDPLNPYLFLFIADGLSNILQRRRDERQIQPLKVCRSAPGVSHLL---FAD 671

Query: 377 DSALYLEGQEANLHRCEQALETFCCASGAPIN 472
DS L+ + + R ++AL+ + +G IN
Sbjct: 672 DSLLFFKAEVIQATRIKEALDLYERCTGQLIN 703


>tr|A3AWW8|A3AWW8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_015290 PE=4 SV=1
Length = 1574

Score = 87.0 bits (214), Expect = 7e-16
Identities = 52/152 (34%), Positives = 76/152 (50%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+QD L LD KAY+RVDW FL+G L+++GF + W + + + V L G E
Sbjct: 924 SQDFCALKLDLSKAYDRVDWGFLDGALQKLGFGNIWRKWIMSCVTSVRYSVRLNGNMLEP 983

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
F TR +R+G PL P+LFLF A+ +S L + LL FAD
Sbjct: 984 FYPTRGLREGDPLNPYLFLFIADGLSNILQRRRDERQIQPLKVCRSAPGVSHLL---FAD 1040

Query: 377 DSALYLEGQEANLHRCEQALETFCCASGAPIN 472
DS L+ + + R ++AL+ + +G IN
Sbjct: 1041 DSLLFFKAEVIQATRIKEALDLYERCTGQLIN 1072


>tr|O82276|O82276_ARATH Putative non-LTR retroelement reverse
transcriptase OS=Arabidopsis thaliana GN=At2g31080 PE=2
SV=1
Length = 1231

Score = 86.3 bits (212), Expect = 1e-15
Identities = 52/160 (32%), Positives = 75/160 (46%)
Frame = +2

Query: 14 GTQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGE 193
G + ++L LD EKAY+RV WDFL+ TL G S+ W + A VL G R +
Sbjct: 429 GRKGWMLLKLDLEKAYDRVRWDFLQETLEAAGLSEGWTSRIMAGVTDPSMSVLWNGERTD 488

Query: 194 RFMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFA 373
F+ R +RQG PL+P+LF+ E + + + +L FA
Sbjct: 489 SFVPARGLRQGDPLSPYLFVLCLERLCHLI---EASVGKREWKPIAVSCGGSKLSHVCFA 545

Query: 374 DDSALYLEGQEANLHRCEQALETFCCASGAPINWRKTVAF 493
DD L+ E A + + LE FC ASG ++ K+ F
Sbjct: 546 DDLILFAEASVAQIRIIRRVLERFCEASGQKVSLEKSKIF 585


>tr|Q53PH7|Q53PH7_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica
GN=LOC_Os11g07520 PE=4 SV=1
Length = 849

Score = 84.0 bits (206), Expect = 6e-15
Identities = 51/164 (31%), Positives = 78/164 (47%)
Frame = +2

Query: 20 QDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGERF 199
Q +IL LDFEKAY++V W FL L++ GF D WI+ + + + + G + F
Sbjct: 291 QSGIILKLDFEKAYDKVQWSFLFDVLQKKGFDDKWIKWIKSATIDGRVAININGEIDQYF 350

Query: 200 MLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFADD 379
R VRQG PL+P LF A+A+S L+ L ++ADD
Sbjct: 351 KTFRGVRQGDPLSPLLFNIVADALSEILLK---AKEAGHLEGLVPHLVQGGLTHLQYADD 407

Query: 380 SALYLEGQEANLHRCEQALETFCCASGAPINWRKTVAFSVGSAP 511
+ L++ + N+ + L F SG IN++K+ +G P
Sbjct: 408 TILFMTNNDQNVITTKFILHCFEAMSGLKINYQKSEVIVLGENP 451


>tr|Q2HS45|Q2HS45_MEDTR RNA-directed DNA polymerase (Reverse
transcriptase) OS=Medicago truncatula
GN=MtrDRAFT_AC157503g30v2 PE=4 SV=2
Length = 653

Score = 83.6 bits (205), Expect = 7e-15
Identities = 56/190 (29%), Positives = 82/190 (43%), Gaps = 1/190 (0%)
Frame = +2

Query: 14 GTQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGE 193
G + L +D K Y+RVDW++L + +MGF+ WI+ M VL+ R
Sbjct: 158 GIKGEAALKIDISKTYDRVDWNYLFSIMEKMGFNPIWIKWMRMSVTMVSYHVLVNDDRVG 217

Query: 194 RFMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFA 373
R +RQG PL+P+LF+ AE MS + + LL FA
Sbjct: 218 PIYPGRGLRQGDPLSPYLFILCAEGMSTLIKQAERNNILHGVKVCKRAPTVSHLL---FA 274

Query: 374 DDSALYLEGQEANLHRCEQALETFCCASGAPINWRKTVAFSVGSAPVPDWMPGEGFRWIP 553
DDS L+ E + L+T+ AS IN +K+ + + PV W+
Sbjct: 275 DDSFLFFRANENETRALKDILDTYANASDQLINMQKSEIYFSRNVPVTKKNTLSNMLWVS 334

Query: 554 PGTAVR-YLG 580
G +R YLG
Sbjct: 335 EGIGIRKYLG 344


>tr|O22148|O22148_ARATH Putative non-LTR retroelement reverse
transcriptase OS=Arabidopsis thaliana GN=At2g45230 PE=2
SV=1
Length = 1374

Score = 83.6 bits (205), Expect = 7e-15
Identities = 48/156 (30%), Positives = 79/156 (50%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+++ + + D KAY+RV+W FLE +R +GF+D WIR + + QVL+ G
Sbjct: 567 SEEFIAIKTDISKAYDRVEWPFLEKAMRGLGFADHWIRLIMECVKSVRYQVLINGTPHGE 626

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
+ +R +RQG PL+P+LF+ E + + L S + LL FAD
Sbjct: 627 IIPSRGLRQGDPLSPYLFVICTEMLVKMLQSAEQKNQITGLKVARGAPPISHLL---FAD 683

Query: 377 DSALYLEGQEANLHRCEQALETFCCASGAPINWRKT 484
DS Y + + L + + +E + ASG +N+ K+
Sbjct: 684 DSMFYCKVNDEALGQIIRIIEEYSLASGQRVNYLKS 719


>tr|Q2QWF4|Q2QWF4_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica
GN=LOC_Os12g09530 PE=4 SV=1
Length = 1100

Score = 83.2 bits (204), Expect = 1e-14
Identities = 51/143 (35%), Positives = 69/143 (48%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+Q+ LD KAY+RVDW +LEG L RMGFS+ WI+ M A V G +
Sbjct: 684 SQEFCAYKLDLAKAYDRVDWQYLEGVLDRMGFSNTWIQWMMACVTSVRYAVRFNGSMLKS 743

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
F +R +RQG PL+P+LFLF A+ +S L S LL FAD
Sbjct: 744 FQPSRGLRQGDPLSPYLFLFVADGLSTILSSAVRTGDLVPLKVCRQAPGISHLL---FAD 800

Query: 377 DSALYLEGQEANLHRCEQALETF 445
DS L+ + ++AL +
Sbjct: 801 DSLLFFKANVEQATVVKEALNLY 823


>tr|A3CFR5|A3CFR5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034137 PE=4 SV=1
Length = 1055

Score = 83.2 bits (204), Expect = 1e-14
Identities = 51/143 (35%), Positives = 69/143 (48%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+Q+ LD KAY+RVDW +LEG L RMGFS+ WI+ M A V G +
Sbjct: 639 SQEFCAYKLDLAKAYDRVDWQYLEGVLDRMGFSNTWIQWMMACVTSVRYAVRFNGSMLKS 698

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
F +R +RQG PL+P+LFLF A+ +S L S LL FAD
Sbjct: 699 FQPSRGLRQGDPLSPYLFLFVADGLSTILSSAVRTGDLVPLKVCRQAPGISHLL---FAD 755

Query: 377 DSALYLEGQEANLHRCEQALETF 445
DS L+ + ++AL +
Sbjct: 756 DSLLFFKANVEQATVVKEALNLY 778


>tr|Q84MQ3|Q84MQ3_ORYSJ Putative reverse transcriptase (Putative
uncharacterized protein) (Retrotransposon protein,
putative, unclassified) OS=Oryza sativa subsp. japonica
GN=OSJNBa0030J19.11 PE=4 SV=1
Length = 818

Score = 82.8 bits (203), Expect = 1e-14
Identities = 48/141 (34%), Positives = 71/141 (50%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+Q L LD KA++RVDWDFL+G L R+GF++ W + + + V G E
Sbjct: 88 SQMFCALKLDLSKAFDRVDWDFLDGVLLRLGFAEKWRKWIMSCVTFVQYSVRFNGNLLEP 147

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
F +R +RQG PL+P+LFLF A+ +S L + LL FAD
Sbjct: 148 FKPSRGLRQGDPLSPYLFLFIADGLSNILEKCKTDGLIQPLKVCRGAPGVSHLL---FAD 204

Query: 377 DSALYLEGQEANLHRCEQALE 439
DS L+ + ++A +AL+
Sbjct: 205 DSLLFFKAEDARQEEIRRALQ 225


>tr|A2XHV0|A2XHV0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11988 PE=4 SV=1
Length = 818

Score = 82.8 bits (203), Expect = 1e-14
Identities = 48/141 (34%), Positives = 71/141 (50%)
Frame = +2

Query: 17 TQDLVILLLDFEKAYNRVDWDFLEGTLRRMGFSDAWIRGMSAWYRQAHSQVLLAGGRGER 196
+Q L LD KA++RVDWDFL+G L R+GF++ W + + + V G E
Sbjct: 88 SQMFCALKLDLSKAFDRVDWDFLDGVLLRLGFAEKWRKWIMSCVTFVQYSVRFNGNLLEP 147

Query: 197 FMLTRSVRQGCPLAPFLFLFYAEAMSRFLVS*QVXXXXXXXXXXXXXXXXDELLDAEFAD 376
F +R +RQG PL+P+LFLF A+ +S L + LL FAD
Sbjct: 148 FKPSRGLRQGDPLSPYLFLFIADGLSNILEKCKTDGLIQPLKVCRGAPGVSHLL---FAD 204

Query: 377 DSALYLEGQEANLHRCEQALE 439
DS L+ + ++A +AL+
Sbjct: 205 DSLLFFKAEDARQEEIRRALQ 225