BP913653
Clone id YMU001_000032_G04
Library
Length 536
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000032_G04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACTGGGGCTATTGCAAGGATTGCACCATGGCGTGCCACCCATCCTGGTGATTGCCCAAG
GGTGGACAATCCATTCAACCATGCTTTGAGTTCATCCTCTTTCAGAAACTGTGAAACCAT
GCCCAAAGCCCTGGCTGCTGAACCTCTGACTTCATCCTCATCAGAGGGAAGAAACTCTTG
CAGACTTAACACTCGGGTCAACACTGGAGCACTCAAATTTTTTCCCGCATGTTTAAGAAT
ACCCTTCAATGCAATCAGCATGGCCTCCTTCACACCTCCATCGGATGTCTGAAGACCATT
CAAAAGATCGCCTACTAAAGGATCTACACGTGTACTAAGAGATGCCAGCTTGCCGAGTGC
CAATGCCGATCTAGAACGTACAGGTCTTGCATTATCCTGAAGGCATTTGATAAAAGTTGT
CTGCAGTTGTGGCAGAAAAGGTTTCAGAGCAAGGCCACCTTTGCTTATAATGATACCGAG
TGTTGCTAGAATTGCGCTTTTGACTTGCCAAGGATATCTATCTCCTATAATACGAA
■■Homology search results ■■ -
sp_hit_id Q92616
Definition sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens
Align length 179
Score (bit) 130.0
E-value 4.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913653|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_G04.
(536 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapie... 130 4e-30
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostel... 102 9e-22
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosacch... 94 3e-19
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyc... 86 1e-16
sp|O60100|IMB4_SCHPO Probable importin subunit beta-4 OS=Schizos... 36 0.13
sp|Q5R6J0|ECM29_PONAB Proteasome-associated protein ECM29 homolo... 34 0.39
sp|Q6PDI5|ECM29_MOUSE Proteasome-associated protein ECM29 homolo... 34 0.39
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=... 34 0.51
sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=... 34 0.51
sp|Q5VYK3|ECM29_HUMAN Proteasome-associated protein ECM29 homolo... 33 0.67
sp|P46056|CARB_TRICU Carbamoyl-phosphate synthase arginine-speci... 33 0.67
sp|Q10704|Y2095_MYCTU Uncharacterized protein Rv2095c/MT2156 OS=... 32 1.9
sp|P11282|VP75_SHV21 Probable membrane antigen 75 OS=Saimiriine ... 32 2.5
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schiz... 32 2.5
sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=... 32 2.5
sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=... 32 2.5
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderom... 32 2.5
sp|Q5BX25|SJ965_SCHJA UPF0506 protein SJCHGC02965 (Fragment) OS=... 31 3.3
sp|Q5DC74|SJ047_SCHJA UPF0506 protein SJCHGC03047 OS=Schistosoma... 31 3.3
sp|Q2FSE6|PYRG_METHJ CTP synthase OS=Methanospirillum hungatei (... 31 3.3
sp|Q7T3E4|DBR1_DANRE Lariat debranching enzyme OS=Danio rerio GN... 31 3.3
sp|P35158|SPMB_BACSU Spore maturation protein B OS=Bacillus subt... 30 5.7
sp|Q28205|TBCD_BOVIN Tubulin-specific chaperone D OS=Bos taurus ... 30 7.4
sp|P55159|PON1_RAT Serum paraoxonase/arylesterase 1 OS=Rattus no... 30 7.4
sp|P49389|RM16_BRANA 60S ribosomal protein L16, mitochondrial OS... 30 9.7
sp|Q89YY3|CLPB_BACTN Chaperone protein clpB OS=Bacteroides theta... 30 9.7

>sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens
GN=GCN1L1 PE=1 SV=5
Length = 2671

Score = 130 bits (327), Expect = 4e-30
Identities = 77/179 (43%), Positives = 107/179 (59%), Gaps = 3/179 (1%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RI+GDR+ W VK+A+L TL ++++K G+ALKPFLPQLQTTF K LQD+ R VR
Sbjct: 2312 RILGDRFSWNVKAALLETLSLLLAKVGIALKPFLPQLQTTFTKALQDSNRGVRLKAADAL 2371

Query: 354 XXXXXXSTRVDPLVGDLLNGLQT-SDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-L 181
+VDPL +LLNG++ D GV++ ML AL+ +++ AG + A + ++S L
Sbjct: 2372 GKLISIHIKVDPLFTELLNGIRAMEDPGVRDTMLQALRFVIQGAGAKVDAVIRKNIVSLL 2431

Query: 180 QEFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSP-GWVARHGAILAIA 7
L DED R S+A LG + FL E+EL A L S W+ RHG LA++
Sbjct: 2432 LSMLGHDEDNTRISSAGCLGELCAFLTEEELSAVLQQCLLADVSGIDWMVRHGRSLALS 2490


>sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium
discoideum GN=gcn1l1 PE=3 SV=1
Length = 2667

Score = 102 bits (255), Expect = 9e-22
Identities = 63/178 (35%), Positives = 99/178 (55%), Gaps = 1/178 (0%)
Frame = -3

Query: 531 IIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXXX 352
+IGD++PWQVKSAIL TL ++ISK ++K FL QLQ TFIKCL D+ + VR
Sbjct: 2318 VIGDKFPWQVKSAILQTLSLLISKSPASMKIFLHQLQPTFIKCLSDSHKNVRTNAASALG 2377

Query: 351 XXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQEF 172
S+ VD LV L+ G+ T+D +E+ L AL+ I + K A + + ++ +F
Sbjct: 2378 LLMTLSSSVDQLVNSLITGISTADSISQESKLRALQSIFEKKPKVEQATLDKAIATIVDF 2437

Query: 171 LPSDEDEVRGSAARALGMVSQ-FLKEDELKAWLNGLSTLGQSPGWVARHGAILAIAPV 1
L D++R A+ +G S+ F EL ++ + + S ++R+G LA+ +
Sbjct: 2438 LYQPSDDLRSMVAQTIGASSKCFTSLTELNQFIK-TNLISPSQSVLSRYGKSLALGEI 2494


>sp|Q10105|GCN1_SCHPO Translational activator gcn1
OS=Schizosaccharomyces pombe GN=gcn1 PE=2 SV=1
Length = 2670

Score = 94.4 bits (233), Expect = 3e-19
Identities = 55/154 (35%), Positives = 87/154 (56%), Gaps = 1/154 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQD-NARPVRXXXXXX 358
RIIG+R+P +VK AIL TL II+SK L+PFLPQLQ TF KCL D ++ +R
Sbjct: 2292 RIIGERFPVEVKCAILYTLNIILSKISTFLRPFLPQLQRTFAKCLGDPSSEVIRSRAATA 2351

Query: 357 XXXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQ 178
TR+ P++ +L++G +T D GV++AML AL ++ +G+N++ + L
Sbjct: 2352 LGTLITLQTRLAPIITELVSGARTPDAGVRKAMLNALFAVVSKSGQNMNEASAEAIEQLL 2411

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWL 76
+ + ++ E A+ G + L + + K L
Sbjct: 2412 DEISAESSEHMVICAKLYGALFSHLPDAQAKQLL 2445



Score = 35.4 bits (80), Expect = 0.18
Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 2/126 (1%)
Frame = -3

Query: 456 GLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXXXXXXXXSTR--VDPLVGDLLNGLQTS 283
G+ +P+LP L + DNA VR + V L+ LL+GL
Sbjct: 1434 GIYFEPYLPDLLPLLLTSFGDNANEVREATMDAVKQIMSQLSAFGVKLLLPTLLDGLNEY 1493

Query: 282 DGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQEFLPSDEDEVRGSAARALGMVSQFL 103
+ K+A + L + A K LS + T + L E L +VR +A ++L +
Sbjct: 1494 NWRSKKASVEILGLMSYMAPKQLSVFLPTIIPKLSEVLTDSHSQVRNTANKSLLRFGDVI 1553

Query: 102 KEDELK 85
E++
Sbjct: 1554 SNPEIQ 1559



Score = 30.8 bits (68), Expect = 4.3
Identities = 33/155 (21%), Positives = 58/155 (37%), Gaps = 3/155 (1%)
Frame = -3

Query: 522 DRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXXXXXX 343
+ Y W+ K A + LG++ L FLP + + L D+ VR
Sbjct: 1491 NEYNWRSKKASVEILGLMSYMAPKQLSVFLPTIIPKLSEVLTDSHSQVRNTANKSLLRFG 1550

Query: 342 XXST--RVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQEF- 172
+ + LV LL L +A+ LK H L P L V+ + ++
Sbjct: 1551 DVISNPEIQTLVPTLLKALSDCTRYTDDALEALLKTSFVH---YLDPPSLALVIPILKYG 1607

Query: 171 LPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGL 67
L + +A+ G+++ + + L +L L
Sbjct: 1608 LRERNAGTKRQSAKIFGLMASLTEPENLAVYLESL 1642


>sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces
cerevisiae GN=GCN1 PE=1 SV=1
Length = 2672

Score = 85.5 bits (210), Expect = 1e-16
Identities = 53/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQD-NARPVRXXXXXX 358
R++G+R+ +K+AIL L ++ K + L+PF+PQLQ TF+K L D +R
Sbjct: 2259 RVVGERFSSDIKAAILFALNVLFIKIPMFLRPFIPQLQRTFVKSLSDATNETLRLRAAKA 2318

Query: 357 XXXXXXXSTRVDPLVGDLLNGL-QTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSL 181
RVDPLV +L+ G Q +D GVK AML AL ++ AG L+ T +++L
Sbjct: 2319 LGALIEHQPRVDPLVIELVTGAKQATDEGVKTAMLKALLEVIMKAGSKLNENSKTNIVNL 2378

Query: 180 -QEFLPSDEDEVRGSAARALGMVSQFLKEDE 91
+E + D++ + A+ +G +S+ L DE
Sbjct: 2379 VEEEMLGSNDKLAVAYAKLIGSLSEILSNDE 2409


>sp|O60100|IMB4_SCHPO Probable importin subunit beta-4
OS=Schizosaccharomyces pombe GN=kap123 PE=2 SV=1
Length = 1067

Score = 35.8 bits (81), Expect = 0.13
Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
Frame = -3

Query: 285 SDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSL-QEFLPSDEDEVRGSAARALGMVSQ 109
S G + AM +A G + ++ P V SL L E EVR +AA ++G++ Q
Sbjct: 864 SKNGNERAMAVACVGEVAGGIESAITPFTRDVFSLFMAALEDSEGEVRSNAAYSMGLLCQ 923

Query: 108 FLKEDELKAWLNGLSTL 58
F ED +LN L L
Sbjct: 924 FSTEDLSSEYLNILQKL 940


>sp|Q5R6J0|ECM29_PONAB Proteasome-associated protein ECM29 homolog
(Fragment) OS=Pongo abelii GN=ECM29 PE=2 SV=2
Length = 1810

Score = 34.3 bits (77), Expect = 0.39
Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 4/142 (2%)
Frame = -3

Query: 510 WQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXXXXXXXXST 331
W + +I ++ G L PFLPQL + D +R +
Sbjct: 1060 WNSRKGAAFGFNVIATRAGEQLAPFLPQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKS 1119

Query: 330 RVD----PLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQEFLPS 163
VD ++ DL+ L ++ V+E+ +AL +L+ G+ L ++ ++ + E L
Sbjct: 1120 MVDKYLKEILQDLVKNLTSNTWRVRESSCLALNDLLR--GRPLD-DIIDKLPEIWETLFR 1176

Query: 162 DEDEVRGSAARALGMVSQFLKE 97
+D+++ S +A + + L +
Sbjct: 1177 VQDDIKESVRKAAELALKTLSK 1198


>sp|Q6PDI5|ECM29_MOUSE Proteasome-associated protein ECM29 homolog
OS=Mus musculus GN=Ecm29 PE=1 SV=2
Length = 1840

Score = 34.3 bits (77), Expect = 0.39
Identities = 31/142 (21%), Positives = 61/142 (42%), Gaps = 4/142 (2%)
Frame = -3

Query: 510 WQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXXXXXXXXST 331
W + +I ++ G L PFLPQL + D +R +
Sbjct: 1090 WNSRKGAAFGFNVIATRAGEQLAPFLPQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKS 1149

Query: 330 RVD----PLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQEFLPS 163
VD ++ DL+ L ++ V+E+ +AL +L+ G+ L V+ ++ + E L
Sbjct: 1150 MVDKYLKEILQDLIKNLTSNMWRVRESSCLALNDLLR--GRPLD-DVIDKLPEMWETLFR 1206

Query: 162 DEDEVRGSAARALGMVSQFLKE 97
+D+++ S +A + + L +
Sbjct: 1207 VQDDIKESVRKAAELALKTLSK 1228


>sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1
SV=1
Length = 890

Score = 33.9 bits (76), Expect = 0.51
Identities = 32/121 (26%), Positives = 48/121 (39%), Gaps = 6/121 (4%)
Frame = -3

Query: 516 YPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVR------XXXXXXX 355
+ W VK + + LG I + P+LP+L I+CL D VR
Sbjct: 409 HEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHW 468

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQE 175
T + PL+ +LL + S+ V+EA A + + A L P L +L
Sbjct: 469 VVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTEL-VPYLAYILDTLV 527

Query: 174 F 172
F
Sbjct: 528 F 528


>sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1
SV=1
Length = 890

Score = 33.9 bits (76), Expect = 0.51
Identities = 32/121 (26%), Positives = 48/121 (39%), Gaps = 6/121 (4%)
Frame = -3

Query: 516 YPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVR------XXXXXXX 355
+ W VK + + LG I + P+LP+L I+CL D VR
Sbjct: 409 HEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHW 468

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQE 175
T + PL+ +LL + S+ V+EA A + + A L P L +L
Sbjct: 469 VVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTEL-VPYLAYILDTLV 527

Query: 174 F 172
F
Sbjct: 528 F 528


>sp|Q5VYK3|ECM29_HUMAN Proteasome-associated protein ECM29 homolog
OS=Homo sapiens GN=ECM29 PE=1 SV=2
Length = 1845

Score = 33.5 bits (75), Expect = 0.67
Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 4/142 (2%)
Frame = -3

Query: 510 WQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXXXXXXXXST 331
W + +I ++ G L PFLPQL + D +R +
Sbjct: 1095 WNSRKGAAFGFNVIATRAGEQLAPFLPQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKS 1154

Query: 330 RVD----PLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLSLQEFLPS 163
VD ++ DL+ L ++ V+E+ +AL +L+ G+ L ++ ++ + E L
Sbjct: 1155 MVDKYLKEILQDLVKNLTSNMWRVRESSCLALNDLLR--GRPLD-DIIDKLPEIWETLFR 1211

Query: 162 DEDEVRGSAARALGMVSQFLKE 97
+D+++ S +A + + L +
Sbjct: 1212 VQDDIKESVRKAAELALKTLSK 1233


tr_hit_id A7PZ14
Definition tr|A7PZ14|A7PZ14_VITVI Chromosome chr4 scaffold_39, whole genome shotgun sequence OS=Vitis vinifera
Align length 177
Score (bit) 207.0
E-value 3.0e-52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913653|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_G04.
(536 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PZ14|A7PZ14_VITVI Chromosome chr4 scaffold_39, whole genome... 207 3e-52
tr|A5C1T3|A5C1T3_VITVI Putative uncharacterized protein OS=Vitis... 207 3e-52
tr|A9RIY6|A9RIY6_PHYPA Predicted protein OS=Physcomitrella paten... 203 5e-51
tr|Q6ASU8|Q6ASU8_ORYSJ Putative translational activator OS=Oryza... 188 2e-46
tr|Q10DS9|Q10DS9_ORYSJ HEAT repeat family protein, expressed OS=... 188 2e-46
tr|Q0DP22|Q0DP22_ORYSJ Os03g0721200 protein (Fragment) OS=Oryza ... 188 2e-46
tr|B8AQQ4|B8AQQ4_ORYSI Putative uncharacterized protein OS=Oryza... 186 9e-46
tr|Q9XIR5|Q9XIR5_ARATH Similar to translational activator OS=Ara... 181 2e-44
tr|Q53K35|Q53K35_ORYSJ HEAT repeat, putative OS=Oryza sativa sub... 174 3e-42
tr|A3AM64|A3AM64_ORYSJ Putative uncharacterized protein OS=Oryza... 174 3e-42
tr|B5DFK9|B5DFK9_RAT Putative uncharacterized protein (Fragment)... 127 3e-28
tr|Q0P5L1|Q0P5L1_BOVIN GCN1L1 protein (Fragment) OS=Bos taurus G... 127 5e-28
tr|Q8CHH7|Q8CHH7_MOUSE MKIAA0219 protein (Fragment) OS=Mus muscu... 126 8e-28
tr|Q8BIX2|Q8BIX2_MOUSE Putative uncharacterized protein OS=Mus m... 126 8e-28
tr|Q6PGM5|Q6PGM5_MOUSE Gcn1l1 protein (Fragment) OS=Mus musculus... 126 8e-28
tr|Q3UHQ5|Q3UHQ5_MOUSE Putative uncharacterized protein OS=Mus m... 126 8e-28
tr|B2RWW6|B2RWW6_MOUSE GCN1 general control of amino-acid synthe... 126 8e-28
tr|Q7T160|Q7T160_DANRE Novel protein similar to human general co... 124 2e-27
tr|B5DE37|B5DE37_DANRE Putative uncharacterized protein (Fragmen... 124 2e-27
tr|A7SAH1|A7SAH1_NEMVE Predicted protein OS=Nematostella vectens... 119 1e-25
tr|A4QNK2|A4QNK2_XENTR Gcn1l1 protein OS=Xenopus tropicalis GN=g... 117 5e-25
tr|A7E222|A7E222_XENLA LOC100125671 protein (Fragment) OS=Xenopu... 116 6e-25
tr|A8HPJ7|A8HPJ7_CHLRE Predicted protein (Fragment) OS=Chlamydom... 112 1e-23
tr|A4S027|A4S027_OSTLU Predicted protein (Fragment) OS=Ostreococ... 111 2e-23
tr|B7PZS4|B7PZS4_IXOSC Putative uncharacterized protein (Fragmen... 110 4e-23
tr|Q177C0|Q177C0_AEDAE Translational activator gcn1 OS=Aedes aeg... 110 6e-23
tr|Q015E4|Q015E4_OSTTA Putative translational activator (ISS) OS... 106 9e-22
tr|Q7PY15|Q7PY15_ANOGA AGAP001700-PA OS=Anopheles gambiae GN=AGA... 103 4e-21
tr|Q7PLL6|Q7PLL6_DROME CG17514, isoform A OS=Drosophila melanoga... 103 6e-21
tr|B0W357|B0W357_CULQU Translational activator gcn1 OS=Culex qui... 103 7e-21

>tr|A7PZ14|A7PZ14_VITVI Chromosome chr4 scaffold_39, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026717001
PE=4 SV=1
Length = 2597

Score = 207 bits (527), Expect = 3e-52
Identities = 109/177 (61%), Positives = 135/177 (76%), Gaps = 1/177 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RIIGDR+PWQVKSAIL+TL III KGG+ALKPFLPQLQTTFIKCLQDN R VR
Sbjct: 2234 RIIGDRFPWQVKSAILSTLSIIIRKGGIALKPFLPQLQTTFIKCLQDNTRTVRSSAALAL 2293

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRV-LSLQ 178
STRVDPLVGDLL+ LQ SDGGV+EA+L ALKG+L+HAGK++S V TRV + L+
Sbjct: 2294 GKLSALSTRVDPLVGDLLSSLQVSDGGVREAILTALKGVLQHAGKSVSVAVRTRVYVLLK 2353

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIA 7
+F+ D+D+VR SAA LG++SQ++++ +L L LS+L S W ARHG+IL I+
Sbjct: 2354 DFVHHDDDQVRNSAASILGILSQYMEDGQLSDLLQELSSLDSSLSWSARHGSILTIS 2410


>tr|A5C1T3|A5C1T3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040059 PE=4 SV=1
Length = 720

Score = 207 bits (527), Expect = 3e-52
Identities = 109/177 (61%), Positives = 135/177 (76%), Gaps = 1/177 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RIIGDR+PWQVKSAIL+TL III KGG+ALKPFLPQLQTTFIKCLQDN R VR
Sbjct: 369 RIIGDRFPWQVKSAILSTLSIIIRKGGIALKPFLPQLQTTFIKCLQDNTRTVRSSAALAL 428

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRV-LSLQ 178
STRVDPLVGDLL+ LQ SDGGV+EA+L ALKG+L+HAGK++S V TRV + L+
Sbjct: 429 GKLSALSTRVDPLVGDLLSSLQVSDGGVREAILTALKGVLQHAGKSVSVAVRTRVYVLLK 488

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIA 7
+F+ D+D+VR SAA LG++SQ++++ +L L LS+L S W ARHG+IL I+
Sbjct: 489 DFVHHDDDQVRNSAASILGILSQYMEDGQLSDLLQELSSLDSSLSWSARHGSILTIS 545


>tr|A9RIY6|A9RIY6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_159348 PE=4 SV=1
Length = 2590

Score = 203 bits (516), Expect = 5e-51
Identities = 106/179 (59%), Positives = 134/179 (74%), Gaps = 1/179 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RIIGDR+PWQVKS+IL TLG++I KGGL+LKPFLPQLQTTF+KCLQD ARPVR
Sbjct: 2243 RIIGDRFPWQVKSSILGTLGVLIIKGGLSLKPFLPQLQTTFLKCLQDTARPVRSRAAWAL 2302

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-LQ 178
STRVDPLVGDLL GLQ ++GGVKEA L+AL+G++ HAGK++SA V RVLS LQ
Sbjct: 2303 GKLSKLSTRVDPLVGDLLTGLQVAEGGVKEATLVALEGVVTHAGKSVSATVNARVLSTLQ 2362

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIAPV 1
L S+ED VR SAA++LG+VSQ++ + E +L+ + T+ + W RHG +A+A V
Sbjct: 2363 GLLNSEEDVVRTSAAKSLGIVSQYVGDAEFSLFLHVICTVAPTSTWQMRHGCTMALASV 2421


>tr|Q6ASU8|Q6ASU8_ORYSJ Putative translational activator OS=Oryza
sativa subsp. japonica GN=B1377B10.19 PE=4 SV=1
Length = 2586

Score = 188 bits (477), Expect = 2e-46
Identities = 98/179 (54%), Positives = 127/179 (70%), Gaps = 1/179 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RI+GDR+PWQVKSAIL+TL IIISKGGLALKPFLPQLQTTF+KCLQDN R VR
Sbjct: 2238 RILGDRFPWQVKSAILSTLTIIISKGGLALKPFLPQLQTTFVKCLQDNNRSVRTRAASAL 2297

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-LQ 178
STRVDPLV DLL+ LQ+ D VKE++L ALKG+++HAGK++S V +R L+
Sbjct: 2298 GKLSALSTRVDPLVSDLLSMLQSGDDAVKESVLSALKGVVRHAGKSVSPVVRSRGCDLLK 2357

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIAPV 1
+ L +D D+VR SAA+A+G + Q+++E+E + L +G P W RHGA+L +
Sbjct: 2358 DLLQADADDVRSSAAKAIGTLCQYMEENETSDLVQTLLNMGTLPDWCTRHGALLTFCSI 2416


>tr|Q10DS9|Q10DS9_ORYSJ HEAT repeat family protein, expressed OS=Oryza
sativa subsp. japonica GN=LOC_Os03g51140 PE=4 SV=1
Length = 1206

Score = 188 bits (477), Expect = 2e-46
Identities = 98/179 (54%), Positives = 127/179 (70%), Gaps = 1/179 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RI+GDR+PWQVKSAIL+TL IIISKGGLALKPFLPQLQTTF+KCLQDN R VR
Sbjct: 858 RILGDRFPWQVKSAILSTLTIIISKGGLALKPFLPQLQTTFVKCLQDNNRSVRTRAASAL 917

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-LQ 178
STRVDPLV DLL+ LQ+ D VKE++L ALKG+++HAGK++S V +R L+
Sbjct: 918 GKLSALSTRVDPLVSDLLSMLQSGDDAVKESVLSALKGVVRHAGKSVSPVVRSRGCDLLK 977

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIAPV 1
+ L +D D+VR SAA+A+G + Q+++E+E + L +G P W RHGA+L +
Sbjct: 978 DLLQADADDVRSSAAKAIGTLCQYMEENETSDLVQTLLNMGTLPDWCTRHGALLTFCSI 1036


>tr|Q0DP22|Q0DP22_ORYSJ Os03g0721200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os03g0721200 PE=4 SV=1
Length = 1261

Score = 188 bits (477), Expect = 2e-46
Identities = 98/179 (54%), Positives = 127/179 (70%), Gaps = 1/179 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RI+GDR+PWQVKSAIL+TL IIISKGGLALKPFLPQLQTTF+KCLQDN R VR
Sbjct: 913 RILGDRFPWQVKSAILSTLTIIISKGGLALKPFLPQLQTTFVKCLQDNNRSVRTRAASAL 972

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-LQ 178
STRVDPLV DLL+ LQ+ D VKE++L ALKG+++HAGK++S V +R L+
Sbjct: 973 GKLSALSTRVDPLVSDLLSMLQSGDDAVKESVLSALKGVVRHAGKSVSPVVRSRGCDLLK 1032

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIAPV 1
+ L +D D+VR SAA+A+G + Q+++E+E + L +G P W RHGA+L +
Sbjct: 1033 DLLQADADDVRSSAAKAIGTLCQYMEENETSDLVQTLLNMGTLPDWCTRHGALLTFCSI 1091


>tr|B8AQQ4|B8AQQ4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13323 PE=4 SV=1
Length = 2056

Score = 186 bits (471), Expect = 9e-46
Identities = 97/179 (54%), Positives = 126/179 (70%), Gaps = 1/179 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RI+GDR+PWQVKSAIL+TL IIISKGGLALKPFLPQLQTTF+KCLQDN R VR
Sbjct: 1708 RILGDRFPWQVKSAILSTLTIIISKGGLALKPFLPQLQTTFVKCLQDNNRSVRTRAASAL 1767

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-LQ 178
S RVDPLV DLL+ LQ+ D VKE++L ALKG+++HAGK++S V +R L+
Sbjct: 1768 GKLSALSMRVDPLVSDLLSMLQSGDDAVKESVLSALKGVVRHAGKSVSPVVRSRGCDLLK 1827

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIAPV 1
+ L +D D+VR SAA+A+G + Q+++E+E + L +G P W RHGA+L +
Sbjct: 1828 DLLQADADDVRSSAAKAIGTLCQYMEENETSDLVQTLLNMGTLPDWCTRHGALLTFCSI 1886


>tr|Q9XIR5|Q9XIR5_ARATH Similar to translational activator
OS=Arabidopsis thaliana GN=F13O11.10 PE=4 SV=1
Length = 2698

Score = 181 bits (460), Expect = 2e-44
Identities = 90/177 (50%), Positives = 125/177 (70%), Gaps = 1/177 (0%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNARPVRXXXXXXX 355
RIIGDR+PWQVKSAILATL I+I +GG+ALKPFLPQLQTTF+KCLQD+ R +R
Sbjct: 2348 RIIGDRFPWQVKSAILATLIILIQRGGMALKPFLPQLQTTFVKCLQDSTRTIRSSAAVAL 2407

Query: 354 XXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIALKGILKHAGKNLSAPVLTRVLS-LQ 178
STR+DPLVGDL+ Q +D GV+EA+L A++G++KHAGK++ V R+ L+
Sbjct: 2408 GKLSALSTRIDPLVGDLMTSFQAADSGVREAILSAMRGVIKHAGKSIGPAVRVRIFDLLK 2467

Query: 177 EFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLNGLSTLGQSPGWVARHGAILAIA 7
+ + ++D+VR SA LG++SQ+L+ +L L ++ L S W ARHG++L I+
Sbjct: 2468 DLMHHEDDQVRISATSMLGVLSQYLEAAQLSVLLQEVNDLSASQNWGARHGSVLCIS 2524


>tr|Q53K35|Q53K35_ORYSJ HEAT repeat, putative OS=Oryza sativa subsp.
japonica PE=4 SV=1
Length = 2591

Score = 174 bits (441), Expect = 3e-42
Identities = 98/204 (48%), Positives = 127/204 (62%), Gaps = 26/204 (12%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNAR---------- 385
RI+GDR+PWQVKSAIL+TL IIISKGGLALKPFLPQLQTTF+KCLQDN R
Sbjct: 2218 RILGDRFPWQVKSAILSTLTIIISKGGLALKPFLPQLQTTFVKCLQDNNRLVLLSFRFAV 2277

Query: 384 ---------------PVRXXXXXXXXXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIA 250
VR STRVDPLV DLL+ LQ+ D VKE++L A
Sbjct: 2278 CSIVLPPLTQNLNNRSVRTRAASALGKLSALSTRVDPLVSDLLSMLQSGDDAVKESVLSA 2337

Query: 249 LKGILKHAGKNLSAPVLTRVLS-LQEFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLN 73
LKG+++HAGK++S V +R L++ L +D D+VR SAA+A+G + Q+++E+E +
Sbjct: 2338 LKGVVRHAGKSVSPVVRSRGCDLLKDLLQADADDVRSSAAKAIGTLCQYMEENETSDLVQ 2397

Query: 72 GLSTLGQSPGWVARHGAILAIAPV 1
L +G P W RHGA+L +
Sbjct: 2398 TLLNMGTLPDWCTRHGALLTFCSI 2421


>tr|A3AM64|A3AM64_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_011886 PE=4 SV=1
Length = 2449

Score = 174 bits (441), Expect = 3e-42
Identities = 98/204 (48%), Positives = 127/204 (62%), Gaps = 26/204 (12%)
Frame = -3

Query: 534 RIIGDRYPWQVKSAILATLGIIISKGGLALKPFLPQLQTTFIKCLQDNAR---------- 385
RI+GDR+PWQVKSAIL+TL IIISKGGLALKPFLPQLQTTF+KCLQDN R
Sbjct: 2076 RILGDRFPWQVKSAILSTLTIIISKGGLALKPFLPQLQTTFVKCLQDNNRLVLLSFRFAV 2135

Query: 384 ---------------PVRXXXXXXXXXXXXXSTRVDPLVGDLLNGLQTSDGGVKEAMLIA 250
VR STRVDPLV DLL+ LQ+ D VKE++L A
Sbjct: 2136 CSIVLPPLTQNLNNRSVRTRAASALGKLSALSTRVDPLVSDLLSMLQSGDDAVKESVLSA 2195

Query: 249 LKGILKHAGKNLSAPVLTRVLS-LQEFLPSDEDEVRGSAARALGMVSQFLKEDELKAWLN 73
LKG+++HAGK++S V +R L++ L +D D+VR SAA+A+G + Q+++E+E +
Sbjct: 2196 LKGVVRHAGKSVSPVVRSRGCDLLKDLLQADADDVRSSAAKAIGTLCQYMEENETSDLVQ 2255

Query: 72 GLSTLGQSPGWVARHGAILAIAPV 1
L +G P W RHGA+L +
Sbjct: 2256 TLLNMGTLPDWCTRHGALLTFCSI 2279