BP913667
Clone id YMU001_000032_H08
Library
Length 310
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000032_H08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TATACCTGCTAAACAAGAAGGATAATTACCAGGTTATCAGTACAAACCAAAAGCAGTCCC
ATATCAACAGCATAAATGGTAGCGGTGCCTTAATACCAGGTAAAGATAGCCTTACATCGA
GACTAAATGGAGCTAAGGAGATAGTGTAACACCCATGCTTGCCTAGTAGGAAGCCAAAAG
AGTGTTCACATTAACATACCGGCAAAAAGTACTCACCAGAAAAGAATCTACTTAGCATAT
CAACCCAAGGCATGCCTCGGCAAATCTACTTAGCCCAAACAGATCACACCAGCACATATA
CATGAAGGTA
■■Homology search results ■■ -
sp_hit_id Q5XJY6
Definition sp|Q5XJY6|FANCB_MOUSE Fanconi anemia group B protein homolog OS=Mus musculus
Align length 38
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913667|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_H08.
(310 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5XJY6|FANCB_MOUSE Fanconi anemia group B protein homolog OS=... 29 6.4
sp|Q04257|U507_YEAST UPF0507 protein YML003W/YML002W OS=Saccharo... 29 8.4
sp|A6ZM60|U507_YEAS7 UPF0507 protein SCY_4172 OS=Saccharomyces c... 29 8.4

>sp|Q5XJY6|FANCB_MOUSE Fanconi anemia group B protein homolog OS=Mus
musculus GN=Fancb PE=2 SV=2
Length = 703

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 5/38 (13%)
Frame = -3

Query: 116 CKAIFTWY*GTA-----TIYAVDMGLLLVCTDNLVIIL 18
C A+F+W TA TIY G+L C D+L+ +L
Sbjct: 545 CGALFSWEQRTASEGILTIYCRSQGVLFQCLDHLIKVL 582


>sp|Q04257|U507_YEAST UPF0507 protein YML003W/YML002W
OS=Saccharomyces cerevisiae GN=YML003W/YML002W PE=1 SV=2
Length = 1090

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/43 (32%), Positives = 25/43 (58%)
Frame = +3

Query: 3 YLLNKKDNYQVISTNQKQSHINSINGSGALIPGKDSLTSRLNG 131
Y+L +N I+TN + SH +++G +I K+++ LNG
Sbjct: 75 YILLMTEN-SYINTNSRDSHYETLDGKTVVIQWKNNVIHALNG 116


>sp|A6ZM60|U507_YEAS7 UPF0507 protein SCY_4172 OS=Saccharomyces
cerevisiae (strain YJM789) GN=SCY_4172 PE=3 SV=1
Length = 1090

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/43 (32%), Positives = 25/43 (58%)
Frame = +3

Query: 3 YLLNKKDNYQVISTNQKQSHINSINGSGALIPGKDSLTSRLNG 131
Y+L +N I+TN + SH +++G +I K+++ LNG
Sbjct: 75 YILLMTEN-SYINTNSRDSHYETLDGKTVVIQWKNNVIHALNG 116


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913667|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_H08.
(310 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******